KEGG   Rhodobacter capsulatus: RCAP_rcc02696Help
Entry
RCAP_rcc02696     CDS       T01213                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rcp  Rhodobacter capsulatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rcp00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rcp00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:rcp03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rcp03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rcp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2888976..2889428
Genome map
AA seq 150 aa AA seqDB search
MPALFYHVTQSPVEGVVETLLTRALAQGWRVELRGVSPERMDWLDQKLWLGPEEDFLPHG
LAGGPHDALQPVLLTTSPRPEGRQAVMTLDGAEVTPAEVAAAERVWILFDGRDETAVARA
RDQWKALTGAGTAAQYWREESGRWQKKAEK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcttttctatcacgtcacccagtcgccggtcgaaggggtggtcgaaacgctg
ctcacccgcgccctggcgcagggctggcgggtggaattgcgcggggtgtcccccgagcgg
atggactggctggaccagaaactctggcttggccccgaggaagactttctgccgcacggg
ctggcgggcgggccgcatgatgcgctgcaacccgtgctcttgaccacctccccgcgcccc
gaggggcggcaggcggtgatgacgctcgacggcgccgaggtcacccccgccgaggtggcg
gcggccgaacgggtctggatcctgttcgacggccgcgacgaaaccgccgtcgcccgcgcc
cgcgatcagtggaaggcgctgaccggggcgggcaccgcggcgcaatactggcgcgaggaa
agcgggcgctggcagaagaaggccgaaaagtag

DBGET integrated database retrieval system