KEGG   Rhodobacter capsulatus: RCAP_rcc02759Help
Entry
RCAP_rcc02759     CDS       T01213                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rcp  Rhodobacter capsulatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rcp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2948971..2949570
Genome map
AA seq 199 aa AA seqDB search
MSGPRDEIEALIAQMARLPGLGPRSARRAVLHLLRKREGQMAPLAAALSRVAETARDCPI
CGNIAMGASCEICDSPARAIGEICVVEDVADLWALERGGAFKGRYHVLGGTLSALDAIGP
EELRIPQLIARIRAEAVTEVILALNATVEGQTTAHYIAEALEGTGVRVTSLAQGVPIGGE
LDYLDDGTISAALRARRAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcccccgcgacgagatcgaggcgctgatcgcgcagatggcgcgactgccgggg
cttggcccccgctctgcccggcgcgcggtgctgcatcttctgcgcaagcgcgaggggcag
atggcgccccttgcggcggcgctgtcgcgggtggccgaaaccgcccgcgattgcccgatc
tgcggcaatatcgcgatgggcgccagctgcgagatctgcgacagccccgcccgcgccatc
ggcgaaatctgcgtcgtcgaggatgtcgccgatctttgggcgctggaacgcggcggcgcc
ttcaagggccgctaccacgttctgggcggcactttgtccgcgcttgatgccatcggcccc
gaggaattgcgcatcccgcagctgatcgcccgcatccgcgccgaggcggtcaccgaggtg
atcctggcgctgaatgccacggtcgaggggcagacgacggcgcattacatcgccgaggcg
ctggagggcacgggggtgcgcgtgacctcgctggcgcagggcgtgccgatcggcggcgaa
ctcgactatctcgatgacggcacgatctcggcggcgctgcgggcgcggcgggcgctgtga

DBGET integrated database retrieval system