KEGG   Rhodobacter capsulatus: RCAP_rcc02796Help
Entry
RCAP_rcc02796     CDS       T01213                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rcp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2987083..2988021
Genome map
AA seq 312 aa AA seqDB search
MIADAPLFHDLAEGPAGGQAWWLTAADGVRLRLVLWGGGAKGTVFLFAGRAEYAEKYGPA
AADLAARGYGTLVIDWRGQGLSDRLIADPVKGFVGKFSDYQRDVDAMLAAAAQLDLPRPW
VVLAHSMGGTIALRRLMGTHPFAAVAFSAPMWGVGLPRAIRPFGPVLARMTGSSPFALRY
APGWGPVTFVHRAGFHDNFLTTDPDMWALLLRQVAKAPGLAIAGASLHWVAEAVLECEAL
ADVPAPDLPCHCALGTRERIVPKAPIRDRMASWPRAELALYDGAEHEVMMEGPAMRARFY
DACAALFDANRG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggacgccccccttttccacgatctggccgaagggcccgcgggcggtcaggct
tggtggctgaccgccgccgatggtgtccggctgcggctggtgctgtggggcgggggggcg
aagggcacggtgttcctgtttgcgggccgggccgaatatgccgagaaatacggtcccgcg
gcggcggatctggcggcgcgcggctatggcacgctggtgatcgactggcgcggacagggg
ctgtcggaccggctgatcgccgatccggtcaagggcttcgtcggcaagttcagcgattat
cagcgcgatgtcgatgcgatgctggcggcggcggcgcagcttgatctgccgcggccctgg
gtcgtgctggcgcattcgatgggcggcacgattgcgctgcgccgtctgatgggaacgcat
ccctttgctgccgttgccttttccgcgccgatgtggggcgtgggcctgccccgggcgatc
cggcctttcgggccggtgctggcgcggatgaccggatcaagcccctttgcgctgcgctat
gcgccgggttgggggccggtcaccttcgtgcatcgcgcggggtttcacgacaatttcctg
accaccgatcccgacatgtgggcgctgctgctgcggcaggtggccaaggcgccggggctg
gcgatcgccggggcctctctgcactgggtggccgaggcggtgctggaatgcgaagccttg
gccgacgtgcccgcgcccgacctgccctgccattgcgcccttggcacgcgggagaggatc
gtgccgaaggcgccgatccgcgaccgcatggcgagctggccgcgcgcggagcttgccctt
tacgacggcgccgagcacgaggtgatgatggaaggccccgcgatgcgggcgcggttctac
gacgcctgcgccgcgctgttcgacgccaaccggggctga

DBGET integrated database retrieval system