KEGG   Rhodobacter capsulatus: RCAP_rcc02796Help
Entry
RCAP_rcc02796     CDS       T01213                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RCAP_rcc02796 (pldB)
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RCAP_rcc02796 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2987083..2988021
Genome map
AA seq 312 aa AA seqDB search
MIADAPLFHDLAEGPAGGQAWWLTAADGVRLRLVLWGGGAKGTVFLFAGRAEYAEKYGPA
AADLAARGYGTLVIDWRGQGLSDRLIADPVKGFVGKFSDYQRDVDAMLAAAAQLDLPRPW
VVLAHSMGGTIALRRLMGTHPFAAVAFSAPMWGVGLPRAIRPFGPVLARMTGSSPFALRY
APGWGPVTFVHRAGFHDNFLTTDPDMWALLLRQVAKAPGLAIAGASLHWVAEAVLECEAL
ADVPAPDLPCHCALGTRERIVPKAPIRDRMASWPRAELALYDGAEHEVMMEGPAMRARFY
DACAALFDANRG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggacgccccccttttccacgatctggccgaagggcccgcgggcggtcaggct
tggtggctgaccgccgccgatggtgtccggctgcggctggtgctgtggggcgggggggcg
aagggcacggtgttcctgtttgcgggccgggccgaatatgccgagaaatacggtcccgcg
gcggcggatctggcggcgcgcggctatggcacgctggtgatcgactggcgcggacagggg
ctgtcggaccggctgatcgccgatccggtcaagggcttcgtcggcaagttcagcgattat
cagcgcgatgtcgatgcgatgctggcggcggcggcgcagcttgatctgccgcggccctgg
gtcgtgctggcgcattcgatgggcggcacgattgcgctgcgccgtctgatgggaacgcat
ccctttgctgccgttgccttttccgcgccgatgtggggcgtgggcctgccccgggcgatc
cggcctttcgggccggtgctggcgcggatgaccggatcaagcccctttgcgctgcgctat
gcgccgggttgggggccggtcaccttcgtgcatcgcgcggggtttcacgacaatttcctg
accaccgatcccgacatgtgggcgctgctgctgcggcaggtggccaaggcgccggggctg
gcgatcgccggggcctctctgcactgggtggccgaggcggtgctggaatgcgaagccttg
gccgacgtgcccgcgcccgacctgccctgccattgcgcccttggcacgcgggagaggatc
gtgccgaaggcgccgatccgcgaccgcatggcgagctggccgcgcgcggagcttgccctt
tacgacggcgccgagcacgaggtgatgatggaaggccccgcgatgcgggcgcggttctac
gacgcctgcgccgcgctgttcgacgccaaccggggctga

DBGET integrated database retrieval system