KEGG   Rhodobacter capsulatus: RCAP_rcc03047Help
Entry
RCAP_rcc03047     CDS       T01213                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCAP_rcc03047 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc03047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCAP_rcc03047 (trpA)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCAP_rcc03047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3237602..3238393
Genome map
AA seq 263 aa AA seqDB search
MTRIDAKFAALKAGGKKAFVAYIMAGDPDLATSAEILKGLPAAGVDIIELGLPFTDPMAD
GTTIQLAGQRALEGGQTLQRTLDMVAAFRKTDDTTPIVLMGYYNPIYNRGVPKFLKDAKE
AGIDGLIVVDLPPEEDSELCIPAAEAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSVT
GITGSQAAQVSDVAPEVARIKAATELPLIVGFGISTPEAARTIAAVADGCVVGSAIVKEI
GAGKSPAEVLATVAALAAGAHSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcatcgacgccaaattcgccgccctgaaggccgggggcaagaaagccttcgtc
gcctatatcatggcgggggacccggatctggcgacctcggccgagatcctgaagggactg
cccgcggcgggggtggacatcatcgagctcggcctgcccttcaccgatccgatggccgat
ggcacgacgatccagctcgcggggcagcgcgcgctggaaggcgggcagacgctgcagcgg
acgctcgacatggtggcggcgttccgcaagaccgatgacacgacgccgatcgtgctgatg
ggctattacaacccgatctacaatcgcggcgttccgaagtttctgaaagacgcgaaagag
gcggggatcgacgggctgatcgtcgtcgacctgccgcccgaagaggattctgaactgtgc
atcccggcggccgaggccggaatcaacttcatccgtctggcgacgccgacgaccgatgac
aagcgcctgccgaaggtgctgcagaacaccagcggctttgtctattacgtctcggtgacc
ggcatcaccggctcgcaggcggcgcaggtgagcgatgtcgcgccggaagtggcgcggatc
aaggcggcgaccgagctgccgctgatcgtcggcttcggcatctcgacccccgaggcggcg
cggacgatcgccgccgtggccgatggctgcgtcgtgggatcggcgatcgtcaaggagatc
ggcgcgggcaaaagcccggccgaggttctggccaccgtcgcggcgctggccgcgggcgcg
cattcggcctga

DBGET integrated database retrieval system