KEGG   Rhodobacter capsulatus: RCAP_rcc03047Help
Entry
RCAP_rcc03047     CDS       T01213                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCAP_rcc03047 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc03047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCAP_rcc03047 (trpA)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCAP_rcc03047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3237602..3238393
Genome map
AA seq 263 aa AA seqDB search
MTRIDAKFAALKAGGKKAFVAYIMAGDPDLATSAEILKGLPAAGVDIIELGLPFTDPMAD
GTTIQLAGQRALEGGQTLQRTLDMVAAFRKTDDTTPIVLMGYYNPIYNRGVPKFLKDAKE
AGIDGLIVVDLPPEEDSELCIPAAEAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSVT
GITGSQAAQVSDVAPEVARIKAATELPLIVGFGISTPEAARTIAAVADGCVVGSAIVKEI
GAGKSPAEVLATVAALAAGAHSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcatcgacgccaaattcgccgccctgaaggccgggggcaagaaagccttcgtc
gcctatatcatggcgggggacccggatctggcgacctcggccgagatcctgaagggactg
cccgcggcgggggtggacatcatcgagctcggcctgcccttcaccgatccgatggccgat
ggcacgacgatccagctcgcggggcagcgcgcgctggaaggcgggcagacgctgcagcgg
acgctcgacatggtggcggcgttccgcaagaccgatgacacgacgccgatcgtgctgatg
ggctattacaacccgatctacaatcgcggcgttccgaagtttctgaaagacgcgaaagag
gcggggatcgacgggctgatcgtcgtcgacctgccgcccgaagaggattctgaactgtgc
atcccggcggccgaggccggaatcaacttcatccgtctggcgacgccgacgaccgatgac
aagcgcctgccgaaggtgctgcagaacaccagcggctttgtctattacgtctcggtgacc
ggcatcaccggctcgcaggcggcgcaggtgagcgatgtcgcgccggaagtggcgcggatc
aaggcggcgaccgagctgccgctgatcgtcggcttcggcatctcgacccccgaggcggcg
cggacgatcgccgccgtggccgatggctgcgtcgtgggatcggcgatcgtcaaggagatc
ggcgcgggcaaaagcccggccgaggttctggccaccgtcgcggcgctggccgcgggcgcg
cattcggcctga

DBGET integrated database retrieval system