KEGG   Rhodobacter capsulatus: RCAP_rcc03047Help
Entry
RCAP_rcc03047     CDS       T01213                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00260  Glycine, serine and threonine metabolism
rcp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01130  Biosynthesis of antibiotics
rcp01230  Biosynthesis of amino acids
Module
rcp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc03047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCAP_rcc03047 (trpA)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCAP_rcc03047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ADE86771
UniProt: D5AQI2
Position
3237602..3238393
Genome map
AA seq 263 aa AA seqDB search
MTRIDAKFAALKAGGKKAFVAYIMAGDPDLATSAEILKGLPAAGVDIIELGLPFTDPMAD
GTTIQLAGQRALEGGQTLQRTLDMVAAFRKTDDTTPIVLMGYYNPIYNRGVPKFLKDAKE
AGIDGLIVVDLPPEEDSELCIPAAEAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSVT
GITGSQAAQVSDVAPEVARIKAATELPLIVGFGISTPEAARTIAAVADGCVVGSAIVKEI
GAGKSPAEVLATVAALAAGAHSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcatcgacgccaaattcgccgccctgaaggccgggggcaagaaagccttcgtc
gcctatatcatggcgggggacccggatctggcgacctcggccgagatcctgaagggactg
cccgcggcgggggtggacatcatcgagctcggcctgcccttcaccgatccgatggccgat
ggcacgacgatccagctcgcggggcagcgcgcgctggaaggcgggcagacgctgcagcgg
acgctcgacatggtggcggcgttccgcaagaccgatgacacgacgccgatcgtgctgatg
ggctattacaacccgatctacaatcgcggcgttccgaagtttctgaaagacgcgaaagag
gcggggatcgacgggctgatcgtcgtcgacctgccgcccgaagaggattctgaactgtgc
atcccggcggccgaggccggaatcaacttcatccgtctggcgacgccgacgaccgatgac
aagcgcctgccgaaggtgctgcagaacaccagcggctttgtctattacgtctcggtgacc
ggcatcaccggctcgcaggcggcgcaggtgagcgatgtcgcgccggaagtggcgcggatc
aaggcggcgaccgagctgccgctgatcgtcggcttcggcatctcgacccccgaggcggcg
cggacgatcgccgccgtggccgatggctgcgtcgtgggatcggcgatcgtcaaggagatc
ggcgcgggcaaaagcccggccgaggttctggccaccgtcgcggcgctggccgcgggcgcg
cattcggcctga

DBGET integrated database retrieval system