KEGG   Rhodobacter capsulatus: RCAP_rcc03096Help
Entry
RCAP_rcc03096     CDS       T01213                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCAP_rcc03096 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc03096 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RCAP_rcc03096 (thrC)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RCAP_rcc03096 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3289133..3290539)
Genome map
AA seq 468 aa AA seqDB search
MRYISTRGQAPVLSFAEAMLTGLARDGGLYVPETVPSLSKDEIAAMAGQSYEEVAYRVMA
PFVGDTFTEAELKGAIAKAYAGFGHVARAPLVQLAPGHFLLELFHGPTLAFKDFAMQIIG
QLFQIALAKQGKRITIVGATSGDTGSAAIEAFKGLENVDVFILFPHGRVSDVQRRQMTTP
AESNVHALALSGTFDDCQNRLKDMFNDFAFRDEVGLAGVNSINWARVLAQVVYYFTAAVS
LGAPGRKISFTVPTGNFGDIFAGFIAREMGLPIEQLVIATNQNDILHRCLSTGEYRMDGV
KPSISPSMDIQISSNFERALFWAYGKDGAAVAQLMEELKTKGGFTVSQGALEALRETYAS
GRVSEAETAQTITEERTRSGELLCPHSAVGVRVGHAHARPETPMVTLATAHPAKFPDAVE
AATGLRPGLPARMADLFERPERVTRVPNDLAALEALIRKARTLGEPRA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatctccacccgggggcaggccccggtcctgagctttgccgaagccatgctg
accgggcttgcccgcgacggcggactttacgtccccgaaacggtgccgagcctgagcaag
gacgagatcgccgcgatggccgggcaaagctacgaggaggtggcctatcgcgtcatggcg
cctttcgtcggcgacaccttcaccgaggcagagctgaaaggcgccatcgccaaggcctat
gcgggcttcggccatgtcgcccgcgcgccgctggtgcagcttgcgccggggcatttcctg
ctcgagctgttccacggcccgacgctggcgttcaaggatttcgccatgcagatcatcggg
cagctgttccagatcgccttggcaaaacagggcaagcgcatcaccatcgtcggcgccacc
agcggcgacaccggatcggccgcgatcgaggccttcaagggccttgagaatgtcgatgtc
ttcatcctgttcccgcacgggcgtgtttcggacgtgcagcgccgtcagatgacgacgccg
gcggaaagcaacgtgcatgcgctggcgctgtcgggcacgttcgacgattgccagaaccgg
ctgaaagacatgttcaacgacttcgccttccgcgatgaggtggggctggccggtgtgaac
tcgatcaactgggcgcgggtgctggcgcaggtggtttattatttcaccgccgcggtcagc
cttggggcgcccggccgcaagatcagcttcaccgtgccgaccgggaactttggcgacatt
ttcgcgggcttcatcgcgcgcgaaatgggcctgccgatcgagcagctggtgattgccacg
aaccagaacgacatcctgcaccgctgcctgagcacgggcgaataccggatggacggggtg
aaaccctcgatcagcccgtcgatggacattcagatttcctcgaacttcgagcgcgcgctg
ttctgggcctatggcaaggacggcgccgccgtggcgcagctgatggaggagctgaagacc
aagggcggcttcaccgtgtcccaaggcgcgctggaggccctgcgcgaaacctatgcctcg
ggccgcgtatcggaggccgagaccgcgcagacgatcaccgaggaacggacgcgttcgggc
gagcttttgtgcccgcattcggccgtgggggtccgcgtcggtcatgcccatgcccgcccc
gagaccccgatggtgacgctggccaccgcgcatccggcgaaattccccgatgcggtcgag
gctgccaccggcctgcgccccggcctgcccgcccgcatggccgatctgttcgagcggccc
gagcgcgtcacccgggtgcccaatgatctggccgcgctggaagccttgatccgcaaggcc
cggacgcttggggagccccgcgcatga

DBGET integrated database retrieval system