KEGG   Rhodobacter capsulatus: RCAP_rcc03319Help
Entry
RCAP_rcc03319     CDS       T01213                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rcp  Rhodobacter capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCAP_rcc03319 (folK)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RCAP_rcc03319 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511887..3512378)
Genome map
AA seq 163 aa AA seqDB search
MLPEEGIRLRALSRFWRSPAFPAGAGPDYVNACAVVSAAMTPEAVLSALHRIEARLGRRR
NARWESRGIDLDLLACGAAIRPDAATEAHWRGLPLDAQMQLAPETLILPHPRLADRAFVL
IPLAEIAPLWRHPVTGKTVGAMLAALDATEKAAMVPFSAPFDG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgaggaggggattcggctgcgggcgctcagccgattctggcgatctccggct
tttccggccggggcggggccggattatgtcaatgcctgtgccgtggtttccgcggcgatg
acgcccgaagcggtgctttcggcgctgcatcgaatcgaggcgcggctggggcgccgtcgc
aatgcgcgctgggaatcgcgcggcatcgaccttgatcttctggcctgcggtgccgcgatc
cggcccgatgcggcgaccgaggcgcattggcgcggcctgccgctggacgcacagatgcag
cttgcgcccgagacgctgatcctgccgcatccgcgtctggccgaccgggccttcgtgctg
attccccttgccgagatcgcgcccctgtggcgtcatccggtcaccggcaagacggtcggt
gcgatgctggcggcgctggacgcgaccgaaaaagcggcaatggtgccgttttctgcccct
ttcgacgggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system