KEGG   Rhodobacter capsulatus: RCAP_rcc03337Help
Entry
RCAP_rcc03337     CDS       T01213                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00620  Pyruvate metabolism
rcp00630  Glyoxylate and dicarboxylate metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01200  Carbon metabolism
Module
rcp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCAP_rcc03337 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc03337 (aceB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RCAP_rcc03337 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADE87061
UniProt: D5AS39
Position
3528629..3530251
Genome map
AA seq 540 aa AA seqDB search
MSLDCPSPTAPPLVLRRLPGQDLVLTPEALAFLAELQTRFGTRIHALMLARARRQARIDA
GALPDYLPETKEIRQGIWEAAPVPEALRDRRVEITGPVERKMMINALNSGARVFMADFED
ATAPSFANILAGHRNMLDYRDGTLEFDDPKTGKSYRVGADPAVLIVRPRGLHMAEANVLL
AGQPISAALFDFGLTLWHCGRALAASGRGPFYYLPKLESHHEARLWNEVFVFAQDRVGLA
RGTIKATVLIETLPAAFEMDEIIWELRDHIAGLNCGRWDYIFSYIKTLRNHKAFTLPDRA
EVTMDRAFLASYAARLVKVCHRRGIHAMGGMAAAIPVRDDAVANERAFAQIRADKLREVG
MGHDGTWVAHPDLVPVAMAVFDAEMPGPNQIRIPRQAWRIEPAMLLRPHEGRVTEAGLRT
NISVALDYLAAWLSGRGAVPIRNLMEDAATAEICRAQLWQWRHHGVSVALAAGGSRGVSS
DWLGELMQQEIATVLDRIGANAFHRGHYATAARLLLEAVTAETLPDFLTTAAYAVLNALD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggattgcccatcccccaccgccccgccgctggtcctgcgccgccttcccggt
caggatcttgtgctgacccccgaggcactggcctttctggccgagctgcagacccgtttc
ggcacccggattcacgcgctgatgctggcgcgcgcgcgccgtcaggcgcggatcgacgcg
ggcgccctgcccgattacctgcccgagacgaaagagatccggcagggcatctgggaggcc
gcgccggtgcccgaggccctgcgcgatcgtcgggtggaaatcaccggcccggtcgagcgc
aagatgatgatcaacgcgctgaactcgggcgcgcgggtgttcatggccgatttcgaggat
gcgacggcgccaagcttcgccaatatccttgccggccatcgcaacatgctcgattaccgc
gacggcacgctggaattcgacgatccgaaaaccggcaaaagctatcgcgtcggcgccgat
ccggcggtgctgatcgtgcggccgcgcgggctgcacatggccgaggcgaatgtgctgctg
gccgggcagccgatctcggcggcgcttttcgatttcggcctgacgctgtggcattgcggc
cgggcgctggcggccagcggccgcggcccgttctattacctgccgaagcttgaaagccac
cacgaggcgcggctgtggaacgaggtcttcgtctttgcccaggaccgcgtcgggctggcg
cggggcacgatcaaggcgacggtgctgatcgaaaccctgcccgccgccttcgagatggac
gagatcatctgggagctgcgcgaccatatcgccgggctgaactgcgggcgttgggattat
attttcagctacatcaagaccttgcgcaaccacaaggcgttcaccctgcccgaccgcgcc
gaggtgacgatggaccgcgcctttctggccagctatgcggcacggctggtcaaggtctgc
caccggcgcggcatccacgccatggggggcatggcggcggcgatcccggtgcgcgacgac
gccgtggcgaacgaacgcgccttcgcccagatccgcgccgacaagctgcgcgaggtgggg
atgggccatgacggcacctgggtcgcccatcccgatctggtgccggtggcgatggcggtc
tttgacgccgagatgccggggccgaaccagatccgcattccgcggcaggcctggcggatc
gaaccggcgatgctgttgcgcccgcatgagggccgggtgaccgaggcgggtctgcgcacc
aatatctcggtggcgctcgactatctggcggcctggctctcggggcgcggcgcggtgccg
atccgcaacctgatggaggatgcggcgacggccgagatctgccgcgcgcagctgtggcaa
tggcgccatcacggcgtgtcggtggcgcttgcggcgggcggcagccggggggtgagttcc
gactggctgggcgagctgatgcagcaggaaatcgccacggtgctggaccggatcggggcg
aacgcctttcaccgcggccattacgccaccgccgcacggctgctgctggaagccgtgacc
gccgaaaccctgcccgatttccttaccaccgccgcctatgcggttttgaacgcgctcgac
tga

DBGET integrated database retrieval system