KEGG   Rhodobacter capsulatus: RCAP_rcc03337Help
Entry
RCAP_rcc03337     CDS       T01213                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc03337 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCAP_rcc03337 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc03337 (aceB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RCAP_rcc03337 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3528629..3530251
Genome map
AA seq 540 aa AA seqDB search
MSLDCPSPTAPPLVLRRLPGQDLVLTPEALAFLAELQTRFGTRIHALMLARARRQARIDA
GALPDYLPETKEIRQGIWEAAPVPEALRDRRVEITGPVERKMMINALNSGARVFMADFED
ATAPSFANILAGHRNMLDYRDGTLEFDDPKTGKSYRVGADPAVLIVRPRGLHMAEANVLL
AGQPISAALFDFGLTLWHCGRALAASGRGPFYYLPKLESHHEARLWNEVFVFAQDRVGLA
RGTIKATVLIETLPAAFEMDEIIWELRDHIAGLNCGRWDYIFSYIKTLRNHKAFTLPDRA
EVTMDRAFLASYAARLVKVCHRRGIHAMGGMAAAIPVRDDAVANERAFAQIRADKLREVG
MGHDGTWVAHPDLVPVAMAVFDAEMPGPNQIRIPRQAWRIEPAMLLRPHEGRVTEAGLRT
NISVALDYLAAWLSGRGAVPIRNLMEDAATAEICRAQLWQWRHHGVSVALAAGGSRGVSS
DWLGELMQQEIATVLDRIGANAFHRGHYATAARLLLEAVTAETLPDFLTTAAYAVLNALD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggattgcccatcccccaccgccccgccgctggtcctgcgccgccttcccggt
caggatcttgtgctgacccccgaggcactggcctttctggccgagctgcagacccgtttc
ggcacccggattcacgcgctgatgctggcgcgcgcgcgccgtcaggcgcggatcgacgcg
ggcgccctgcccgattacctgcccgagacgaaagagatccggcagggcatctgggaggcc
gcgccggtgcccgaggccctgcgcgatcgtcgggtggaaatcaccggcccggtcgagcgc
aagatgatgatcaacgcgctgaactcgggcgcgcgggtgttcatggccgatttcgaggat
gcgacggcgccaagcttcgccaatatccttgccggccatcgcaacatgctcgattaccgc
gacggcacgctggaattcgacgatccgaaaaccggcaaaagctatcgcgtcggcgccgat
ccggcggtgctgatcgtgcggccgcgcgggctgcacatggccgaggcgaatgtgctgctg
gccgggcagccgatctcggcggcgcttttcgatttcggcctgacgctgtggcattgcggc
cgggcgctggcggccagcggccgcggcccgttctattacctgccgaagcttgaaagccac
cacgaggcgcggctgtggaacgaggtcttcgtctttgcccaggaccgcgtcgggctggcg
cggggcacgatcaaggcgacggtgctgatcgaaaccctgcccgccgccttcgagatggac
gagatcatctgggagctgcgcgaccatatcgccgggctgaactgcgggcgttgggattat
attttcagctacatcaagaccttgcgcaaccacaaggcgttcaccctgcccgaccgcgcc
gaggtgacgatggaccgcgcctttctggccagctatgcggcacggctggtcaaggtctgc
caccggcgcggcatccacgccatggggggcatggcggcggcgatcccggtgcgcgacgac
gccgtggcgaacgaacgcgccttcgcccagatccgcgccgacaagctgcgcgaggtgggg
atgggccatgacggcacctgggtcgcccatcccgatctggtgccggtggcgatggcggtc
tttgacgccgagatgccggggccgaaccagatccgcattccgcggcaggcctggcggatc
gaaccggcgatgctgttgcgcccgcatgagggccgggtgaccgaggcgggtctgcgcacc
aatatctcggtggcgctcgactatctggcggcctggctctcggggcgcggcgcggtgccg
atccgcaacctgatggaggatgcggcgacggccgagatctgccgcgcgcagctgtggcaa
tggcgccatcacggcgtgtcggtggcgcttgcggcgggcggcagccggggggtgagttcc
gactggctgggcgagctgatgcagcaggaaatcgccacggtgctggaccggatcggggcg
aacgcctttcaccgcggccattacgccaccgccgcacggctgctgctggaagccgtgacc
gccgaaaccctgcccgatttccttaccaccgccgcctatgcggttttgaacgcgctcgac
tga

DBGET integrated database retrieval system