KEGG   Rhodobacter capsulatus: RCAP_rcc03338Help
Entry
RCAP_rcc03338     CDS       T01213                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00630  Glyoxylate and dicarboxylate metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01200  Carbon metabolism
Module
rcp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc03338 (aceA)
Enzymes [BR:rcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RCAP_rcc03338 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ADE87062
UniProt: D5AS40
Position
3530375..3531985
Genome map
AA seq 536 aa AA seqDB search
MTKRQTFSEIRSAILSRYPCGVTPGGVAVDDIVQLRLQNTWDTHLDIARAMAGVMRADMA
AYDADPTKFTQSLGCWSGFHAQQMIKAVKRMRGTARGTYVYLSGWMVAGLRNRWGHLPDQ
SMHEKTAVADLIAEIYTSLRQADEVAMNDLFKALKAAQTETERQAAIAAIDGFETHVVPI
IADIDAGFGNEHATYLLAKELIKAGACCLQIENQVSDAKQCGHQDGKVTVPREDFIEKLR
ACRLAFEELGVEDGVIVARTDSLGAGLTQKVPVSQRPGDLASDYIKWLATAPISAENPIR
EGELALYQNGAFVKPQRLANGLFPFRPGTGRARVVEDCIASLTLGGADLLWIETDTPNVD
EIAGMVAEIRKVVPDAKLTYNNSPSFNWTLNLRKQVRAQWLAEGTITEDAYPNGPELMKP
DYDDTPFGREADAWLKAFQTEIATRAGVFHNLITLPTFHLTAKSMDELSRGYFGEDKMLA
YVATVQRAEIRGGVSAVKHQHEVGSDLGDTFKEMVAGERALKAGGHANTMNQFAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagacagactttttcggaaatccgctccgctatcctgtcccgctacccctgc
ggggtcacgccgggtggcgtggcggtcgatgacatcgtgcagctgcggctgcaaaacacc
tgggacacgcatcttgatatcgcgcgggcgatggccggggtgatgcgcgccgacatggcg
gcctatgacgccgatccgacgaaattcacgcaaagtcttggctgctggtcgggctttcac
gcgcagcagatgatcaaggcggtcaagcggatgcggggcacagcgcgcggcacctatgtc
tatctgtcgggctggatggtcgccggtctgcgcaaccgctggggccatctgcccgatcag
tcgatgcatgaaaagaccgccgtcgccgatctgatcgccgagatctacacctccttgcgg
caggcagatgaggtcgcgatgaacgatctcttcaaggcgctgaaagccgcgcagaccgag
accgagcggcaggcagcgattgcggcgatcgacgggttcgaaacccatgtcgtgccgatc
atcgccgatatcgacgcaggctttggcaacgaacatgcgacctatcttctggcgaaagag
ctgatcaaagccggggcctgctgtttgcagatcgaaaatcaggtctcggatgccaagcaa
tgcggccatcaggacggcaaggtgacggtcccgcgcgaggatttcatcgaaaagctgcgc
gcctgtcggctggccttcgaggagctgggggtggaagacggggtgatcgtcgcccgcacc
gacagtctgggcgccggtctgacgcagaaggtgccggtgtcgcaacgcccgggcgatctg
gcctcggactacatcaaatggctggcgaccgcgccgatcagcgccgaaaacccgatccgc
gagggcgaactggcgctttatcagaacggcgccttcgtcaagccgcagcggctggcgaac
gggcttttcccgttccgccccggcaccggccgcgcccgggtggtggaagattgcatcgcc
tcgctgacgctggggggcgccgatcttttgtggatcgagaccgacacgccgaatgtcgat
gaaatcgccgggatggtggccgagatccgcaaggtcgtgcccgatgcgaagctgacctac
aacaactcgcccagcttcaactggacgctgaacctgcgcaagcaggtgcgcgcgcagtgg
ctggccgagggcacgatcaccgaagacgcttatccgaacgggcccgagctgatgaagccc
gactatgacgacacgcccttcggccgcgaagccgatgcgtggctcaaggccttccagacc
gagatcgcgacgcgggcgggggtgttccacaacctgatcaccctgcccaccttccatctg
accgcgaaatcgatggatgaactctcgcgcggctatttcggcgaagacaagatgctggcc
tatgtcgccacggtgcagcgcgcggaaatccgcggcggcgtctcggcggtgaagcaccag
cacgaggtcggctcggatctgggcgacacgttcaaggagatggtcgcgggcgaacgcgcg
ctgaaggcgggcgggcatgccaatacgatgaaccagttcgcggcagagtga

DBGET integrated database retrieval system