KEGG   Rhodobacter capsulatus: RCAP_rcc03532Help
Entry
RCAP_rcc03532     CDS       T01213                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rcp  Rhodobacter capsulatus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rcp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3736738..3737583
Genome map
AA seq 281 aa AA seqDB search
MPELPEVETVRRGLAPAMEGRVIDRAEVNRPDLRWPLPEAMAERLTGARVDRLRRRSKYI
LADLSTGESLLIHLGMSGRMLVSGVMLGDFHLDHPAAQKHDHVVLHMEGGARVTFNDARR
FGAMDLVRTDREAAHWLLAGLGPEPFGNDFNEAYLIDALKSRKSPIKTALLDQHVVAGLG
NIYVSEVLFRAGIDPRRAANRIAAARLAGLVPLIREVLAEAIEAGGSSLRDHRQADGELG
YFQHSFRVYDREDDPCPACATPIKRIVQSGRSSYFCPACQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaggtcgagacggtccgacgcggcctggcccccgcgatggagggg
cgggtgatcgaccgggccgaggtgaaccgccccgatctgcgctggcccctgcccgaagcc
atggccgagcggctgaccggggcgcgggtggaccggctgcggcggcgctcgaaatacatc
ctggccgatctgtcgaccggggaaagcctgctcattcatctgggcatgtcggggcggatg
ctggtgtccggcgtgatgctgggcgattttcacctggatcatccggcggcgcaaaagcat
gaccacgtggtcttgcacatggaggggggcgcccgggtcaccttcaacgatgcgcggcgg
ttcggggcgatggatcttgtgcgcaccgaccgcgaggcggcgcattggcttttggccggt
cttggccccgagcctttcggcaatgacttcaacgaggcttacctgatcgacgcgctgaaa
tcccgcaagagcccgatcaagaccgcgcttctggatcagcatgtcgtcgccgggcttggc
aatatctatgtgtcggaggtgctgttccgggcgggcatcgatccgcgccgggcggcaaac
cggattgcggcggcgcggctggcggggctcgtgccgctcatccgcgaggttctggccgag
gcgatcgaagcgggcggatcctccctgcgcgatcatcggcaggcggatggggagcttggc
tatttccagcacagcttccgcgtctatgaccgcgaggacgacccctgccccgcctgcgcc
acgccgatcaaacgcatcgtgcaatcgggacggtcgagttatttctgccccgcctgccag
aagtga

DBGET integrated database retrieval system