KEGG   Rhodobacter capsulatus: RCAP_rcp00075Help
Entry
RCAP_rcp00075     CDS       T01213                                 

Gene name
nosZ
Definition
(GenBank) nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00910  Nitrogen metabolism
rcp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RCAP_rcp00075 (nosZ)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RCAP_rcp00075 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 DUF3804 Cu-oxidase_2
Motif
Other DBs
NCBI-ProteinID: ADE87331
UniProt: D5AVJ6
Position
pRCB133:complement(59364..61310)
Genome map
AA seq 648 aa AA seqDB search
MTEETRSGISRRMLLGATAGGAALAGGLAGRLALGTGIGAATLATAAQAEGATGGFEVAP
GQLDEYYGFWSSGQSGEMRILGVPSMRELMRVPVFNRCSATGWGQTNESLRVHQRAMTEH
TKKFLAANGKKIHDQGDLHHVHMSFTEGKYDGRFLFMNDKSNTRVARVRCDVMKCDAILE
IPNAHAIHGLRPQKWPRSNYVFCNGEDETPLANDGATMDDVGTYVNIFTAVDADKWDVAW
QVIVSGNLDNCDADYEGKWAFSTSYNSEMGMNTAQMTASDMDHVVVFNIAEIEKGIKAGD
YQTLNGVKVIDGRKGSNKNYTRYIPVANNPHGCNMAPDKVHLCIGGKLSPTVTVIDVTKL
DTLFASDVDPRSVVVAEPELGLGPLHNAFDGKGNVYTSLFLDSQVVKWNIDLAKRLYAGE
KVDPILDKCDVQYQPGHLKTSMGETLEADGKWLVCLCKFSKDRFLNVGPLKPENDQLIDI
SGDKMKVVHDGPNFAEPHDAIAVHASKMTGIKSIWDRNDPFWAETRKQAEADGVDLDDEQ
AFVIRDKADPTKVRVYMSAVAPNYAMESFEVNEGDEVTMVITNLDDIDDLTHGFTMGGHG
VAMEIGPQATSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMFVRPKA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggaaaccagatccggcatcagccgcaggatgcttctgggcgccaccgcgggc
ggcgcggcgctggcgggcgggcttgccggccgtctggcgcttggcaccgggatcggcgcg
gcgacgctggccaccgcggcgcaggccgaaggcgccacgggcggcttcgaggtcgccccg
ggccagctggacgaatattacggcttctggtcctcgggccagtcgggcgagatgcgcatt
ctcggcgtgccctcgatgcgcgagctgatgcgggttccggtgttcaaccgctgctcggcc
accggctgggggcagacgaatgagtcgctgcgcgtgcatcagcgcgcgatgaccgaacac
acgaagaaattcctcgcggccaacggcaagaagatccacgatcagggcgatctgcaccac
gtccacatgtccttcaccgagggcaagtatgacggccgcttcctgttcatgaatgacaag
tcgaatacccgcgtcgcccgggtgcgctgcgacgtgatgaaatgcgatgcgatcctcgaa
atcccgaatgcgcacgccatccacgggctgcggccgcagaaatggccgcgctcgaattac
gtcttctgcaacggcgaggatgaaacgccgctggccaatgacggcgcgacgatggacgac
gtgggcacttacgtgaacatcttcaccgcggtcgatgccgacaagtgggatgtggcgtgg
caggtgatcgtgtccggcaacctcgacaattgcgacgccgattacgaaggcaaatgggcg
ttctcgaccagctacaacagcgaaatgggcatgaacaccgcccagatgaccgcctcggac
atggaccatgtcgtcgtcttcaacatcgccgagatcgaaaagggcatcaaagcgggcgac
tatcaaacgctcaacggcgtcaaggtgatcgacggccgcaagggctcgaacaagaactac
acccgctacatccccgtcgcgaacaacccgcatggctgcaacatggcccccgacaaggtg
cacctgtgcatcggcggcaagctctcgcccaccgtcacggtgatcgacgtcacgaagctg
gacacgctgtttgcctcggatgtcgatccgcgttcggtcgtggtggcggaaccggaactg
gggctgggcccgctgcacaacgcctttgacggcaagggcaatgtctatacctcgctcttc
ctcgacagccaggtggtgaaatggaacatcgatctggccaagcggctttacgcgggcgaa
aaggtcgatccgatcctcgacaaatgcgacgtgcaatatcagccgggccacctcaagacc
tcgatgggcgagaccctcgaggccgatggcaagtggctggtttgcctgtgcaaattctcc
aaggaccggttcctgaacgtcgggccgctgaagcccgaaaacgaccagctgatcgacatc
tcgggcgacaagatgaaggtcgtgcacgacgggccgaacttcgcggaaccgcatgatgcg
attgccgtgcatgcctcgaagatgacgggcatcaaatcgatctgggaccgcaacgacccg
ttctgggccgagacgcgcaaacaggccgaggccgatggcgtcgatctggacgacgaacag
gcctttgtcatccgcgacaaggccgatccgaccaaggtccgcgtctacatgtcggccgtg
gcgccgaactatgcgatggaaagcttcgaggtgaacgagggcgacgaggtgacgatggtc
atcaccaacctcgatgacatcgacgacctgacgcatggcttcaccatgggcggccacggc
gtggcgatggagatcggaccgcaggcgacctcgtcggtcaccttcgtcgccgccaatccg
ggcgtctactggtattactgccagtggttctgccacgcgctgcacatggaaatgcgcggc
cgcatgttcgtgcgtccgaaggcgtaa

DBGET integrated database retrieval system