KEGG   Ricinus communis (castor bean): 8284720Help
Entry
8284720           CDS       T01087                                 

Definition
(RefSeq) fructan 6-exohydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8284720
   00500 Starch and sucrose metabolism
    8284720
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8284720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 517 aa AA seqDB search
MNDPNGPMIYNGIYHLFYQYNPKGAVWGNIEWGHSTSEDLVNWTPHEPAIYPSQQADING
AFSGSATILPDGTPAILYTGIDPLNQQVQNLALPKNSSDPYLIEWVKLAENPLMAPTSQN
QIEASSFRDPTTAWKGIDGSWRVVIGSKNKTKGLGIIYRSKDFVNWVQAERPIYEVEGTG
MWECPDFFPVAINTNTGVDLSNLGPDIKYVLKASLFDINQDYYAIGEYDGVEDVYTPDTG
SISGDGGLRFDYGKFYASKSFFDSDKKRRILWAWIAESSSVDDDIKKGWAGLQGVPRVIL
LDKSRKQLVQWPIEEIEKLRVNPVHLPLKVLEGGSLLEVSGVTAAQADVEISFRVANIEK
IEVLNQDVTQINPQMLCSQKGASVKGSLGPFGLHVFALKGMQEHTSIFFRIFKVQNKYVV
LMCSDQSRSSLNPTTNKTIYGTFLDVDPLHEELSLRCLIDHSIVESFGGKGKSCITARVY
PELAINEAASLYAFNNGSESVTITRLSAWSMKKAKIN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatccaaatgggccaatgatttacaatggaatttaccatctgttctaccaatac
aatcctaaaggtgcagtgtggggaaacattgaatggggccactcaacatcagaagatctt
gttaattggaccccgcatgaaccagccatttacccatctcagcaagctgatatcaatggc
gccttttctggttcagccacaattctgccagatggcactcctgccattctctatacagga
attgacccattaaaccaacaagtccagaacctggccttgcccaaaaactcatctgatcca
taccttattgaatgggtgaagttagcggaaaacccactaatggcacccacttcccaaaac
caaatcgaggcttcttcatttagagacccaactacagcttggaaaggtattgatggaagt
tggagagtagtcattggaagcaaaaataagactaagggattaggaattatttatagaagt
aaagattttgttaattgggtccaagcggaacgtccaatctatgaagtagagggcaccggt
atgtgggaatgcccggatttctttccggtagcaattaatacaaatactggagttgattta
tcgaatcttggacctgatattaaatatgtacttaaagcgagtttatttgatataaatcag
gattactatgctattggagagtatgatggtgttgaggatgtttatactccagatactgga
tcaatcagtggtgatgggggattaagatttgattatgggaaattttatgcttcaaaatct
ttctttgatagtgataagaagagaaggatattgtgggcatggatagctgaatcttcgagt
gttgatgatgatatcaagaagggttgggctggacttcagggggttccaagagttattttg
cttgacaaatcaagaaagcaactggtgcaatggccaatagaggaaattgaaaagcttcgc
gtgaatccagtccacttgcctctaaaagtccttgaaggagggtccttgcttgaagtttct
ggggtcacggcagcacaggcagatgtggagatttcatttagggtagcaaacattgaaaaa
atagaagtgctgaaccaagatgtaactcagataaacccacaaatgctatgtagccaaaag
ggtgcatcagttaaaggaagtttaggtccatttgggttgcatgtatttgctttaaaagga
atgcaagagcacacatcaattttctttagaatattcaaagtccagaacaaatatgtggtg
ctcatgtgcagtgaccaaagcaggtcttcattgaatcctactactaataagacaatttat
gggacctttttggatgttgatccccttcatgaggagctgtccttaagatgcttgattgat
cattcaatagtggagagctttggtgggaaaggaaagagttgcattacagcaagagtttat
ccagaattggctataaatgaggccgccagcttgtatgcttttaataatggaagtgaaagt
gtcaccataacaagattgagtgcttggagtatgaagaaggctaaaatcaattga

DBGET integrated database retrieval system