KEGG   Ricinus communis (castor bean): RCOM_0000900Help
Entry
RCOM_0000900      CDS       T01087                                 

Definition
(RefSeq) triosephosphate isomerase, putative (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_0000900
   01230 Biosynthesis of amino acids
    RCOM_0000900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0000900
   00051 Fructose and mannose metabolism
    RCOM_0000900
   00562 Inositol phosphate metabolism
    RCOM_0000900
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCOM_0000900
Enzymes [BR:rcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCOM_0000900
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCOM_0000900
  Exosomal proteins of bladder cancer cells
   RCOM_0000900
  Exosomal proteins of melanoma cells
   RCOM_0000900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTSEEVKKIVSTLNEGHVPSSDVVEVVISPPFVFLPLVKDSLKPDF
HVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRLLLSESNEFVGDKVAYALSQ
GLKVIACVGETLEQREAGSTMDVVAAQTKAIAERVKDWADVVLAYEPVWAIGTGKVATPA
QAQEVHFELRKWLKENTSSQVAATTRIIYGGSVTATNCKELAAQPDVDGFLVGGASLKPE
FIEIIKSAEVKKSV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaagtttttcgttggcggcaactggaaatgcaatggaacaagtgaagaagtg
aagaagatagtctccacactcaatgaagggcacgtgccatcctcagatgtggttgaggtt
gtgataagccctccatttgtgtttctcccgctggtgaaagattcactgaagcctgatttt
catgttgcggctcaaaattgttgggtcaagaaaggtggtgcttttaccggcgaagttagt
gcggaaatgcttgtgaatctgagtattccttgggtaattcttggccattctgaaagaaga
cttcttttaagcgagtcaaatgagtttgttggggataaggttgcatatgcactttctcaa
ggtttaaaggtaatagcttgcgtcggtgagactctcgagcagcgtgaagcgggatctacc
atggatgttgttgctgcacaaaccaaagcaatagcagaacgagtaaaggattgggcagat
gttgttttggcatatgagcctgtgtgggctattggaacagggaaggttgcaactcctgct
caggcacaggaagtgcattttgaactgaggaaatggcttaaagagaacaccagttcacaa
gttgctgcaacaaccaggattatctatggagggtcagtcactgctacaaactgcaaggaa
ttggcagcacagcctgatgttgatggatttctggttggtggagcctctctaaagccggag
ttcattgaaattatcaagtccgcagaggtgaagaaaagtgtctga

DBGET integrated database retrieval system