KEGG   Ricinus communis (castor bean): RCOM_0004440Help
Entry
RCOM_0004440      CDS       T01087                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     RCOM_0004440
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_0004440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MLSVSVKWQKKVFPQVEIDTSQPPYLFKCQLFDLTGVPPERQKIMVKGGLLKDDADWATV
GVKEGQKLMMMGTADEIVKAPEKGPVFMEDLPEEEQVVAVGHTAGLFNLGNTCYMNSTVQ
CLHSVPELKSALVKYPSDRRNDLDQTSHMLTTATRELFNELDKSVKPVAPMQFWMVLRKK
YPQFGQLHNGLFMQQDAEECWTQLLYTLSQSLRPPSPSENPDTVKELFGIDLVSRIHCQE
SGEESSETESVYSLKCHISQDVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINDLP
RYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYDFCSADLRKQLEAPRQILRDEEGRK
LGLKVNEKSSGSKDNDVKMTDAEGPSSGSGESSKATSEEGESSHKVSSLTGIYDLVAVLT
HKGRSADSGHYVAWVKQESGKWIEYDDDNPIPQREEDITKLSGGGDWHMAYICMYKARAV
PM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctttcagtgagtgtaaaatggcaaaagaaggtctttccacaagtggagattgacacg
agccagcccccttatcttttcaagtgccaattgtttgatctaactggagtgccccccgag
aggcaaaaaattatggttaagggtggtttattgaaggatgatgctgattgggcaacagta
ggagtgaaggagggtcaaaaattgatgatgatgggaactgcagatgagattgtgaaagcc
cctgagaagggccctgttttcatggaagatcttccagaagaagagcaagtggttgctgtg
ggtcatactgctggcctatttaatctgggaaacacctgttacatgaactctacagtacag
tgtttgcattctgttccagagttgaagtctgctttagtaaagtatccatctgacaggaga
aatgatttggatcagacatctcatatgttgacaactgcaactcgtgagctgtttaatgag
cttgataaaagtgtcaagcctgtggcacctatgcagttttggatggtgttgcgcaaaaag
tatccacaatttggtcaattgcataatggtctcttcatgcagcaggatgctgaagaatgt
tggacacaacttttatacactctttcacagtctcttagaccaccaagtcccagtgaaaat
ccggatacagtgaaagaactttttgggattgatcttgtaagcaggatacattgccaagaa
agtggcgaagagagttcagagacagaatcagtttattcacttaagtgccacatatcacag
gatgtgaaccatttgcatgaaggactaaagcatggcttgaaatctgagctggagaaagct
tccccttccttagggcgtagtgcaatttatttgaaagagtcttgcatcaatgatttgcca
aggtacttgactgttcaatttgttcgatttttctggaagagggagtcaaatcagaaggcc
aagattttgcgtaaagtggattacccattagagctggatgtttatgatttctgttcagct
gatcttcgcaaacaattggaagcacctcgccagattctacgggatgaggagggtagaaag
cttggcttgaaagtaaatgagaaaagctctggctcaaaagataacgatgtcaagatgact
gatgcagagggaccatccagtggaagtggggaatcttcaaaggccacatctgaagagggt
gaatcgtcacacaaagtatcaagtctaactggaatatatgatttagttgctgtgctgacc
cataaagggagaagcgccgattcagggcattatgttgcttgggtaaaacaagaaagtggg
aaatggatcgagtatgatgatgataaccccatcccacagcgggaggaagatataacgaaa
ctctctggaggaggtgactggcatatggcgtatatttgtatgtacaaggcacgtgctgtc
cccatgtaa

DBGET integrated database retrieval system