KEGG   Ricinus communis (castor bean): RCOM_0022940Help
Entry
RCOM_0022940      CDS       T01087                                 

Definition
starch branching enzyme II, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rcu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 863 aa AA seqDB search
MMYYAISGIRLPSVIFKSQSTGSHGTTTTDRITTSGLSFFLKKQPFSRKIFAEKSLSYNS
DSSNITVAAASEKILVPGGETYDDSSSSPSPKDQLVTNDAVSEEEPQVPNDVDTPTMEDG
EDVKDEVEQEKPASLHKTVNIGKSESKPRSIPPPGRGQRIYEIDPSLTSFHQHLDYRYSQ
YKRLREEIDKFEGGLDAFSRGYEKFGFTRSETGITYREWAPGATWAALIGDFNNWNPNAD
VMTRNEFGVWEIFLPNNADGSPPIPHGSRVKIRMDTPSGIKDSIPAWIKFSVQAPGEIPY
NGIYYDPPEEEKYVFKHSQPKRPKSLRIYESHVGMSSTEPIINTYANFRDDVLPRIKRLG
YNTVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELDLLVLMDIVHSH
SSNNTLDGLNMFDGTDGHYFHSGSRGYHWMWDSRLFNYGSWEVLRFLLSNARWWLDEYKF
DGFRFDGVTSMMYTHHGLEVAFTGNYNEYFGFATDVDAVVYLMLVNDMIHGLFPEAVTIG
EDVSGMPTFCIPVEDGGVGFNYRLHMAIADKWIELLQLKDEDWKMGDIVHTLTNRRWMEN
CVAYAESHDQALVGDKTIAFWLMDKDMYDFMSLDRPSTPLIDRGIALHKMIRLATMGLGG
EGYLNFMGNEFGHPEWIDFPRGDQHLPSGKIIPGNNFSYDKCRRRFDLGDADYLRYHGMQ
EFDQAMQHLEEAYGFMTSEHQYISRKDEGDRIIVFERGNLVFVFNFHWNNSYSDYQVGCL
KPGKYKIVLDSDNSLFGGFSRINHSAEYFSFEGWYDNRPRSFLVYAPSRTAVVYALVEDE
KEHLQDADDNKNNNSEHEEPVNG
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgatgtattacgcaatatcaggaatacgtcttccctctgttattttcaaatctcaatca
accggctcccatggcaccaccaccactgatcgtatcaccacctccggtctctctttcttt
ttgaagaaacagccgttttctcggaagatctttgctgaaaagtccctctcttataattct
gattcctcgaatataacagtcgctgctgcgtccgagaaaattcttgttccaggtggtgag
acttatgatgactcttcttcttctccttctccaaaagatcaattagtgactaacgacgcc
gtttcagaagaagaacctcaggtgcctaatgatgtagatacacccacaatggaggacggt
gaagatgtcaaggatgaagtggaacaagaaaaacctgcttctttgcataagacagtcaac
attggaaaaagtgaatctaaaccaaggtccattcctccacctggtcgtggacagagaata
tatgaaatagatccaagcttgaccagtttccatcagcatctcgattacaggtattcgcag
tacaaaagattgcgtgaagaaattgacaaatttgaaggtggtttggatgctttttctcgt
ggctatgaaaagtttggtttcacgcgcagtgaaacaggtatcacttatagggaatgggca
ccaggagctacgtgggctgcactgataggagattttaacaactggaatcccaatgcagac
gttatgactcggaatgaatttggtgtctgggagatctttttgccaaataacgcagatggt
tcaccaccaattccccatggttctcgagtgaagatacgcatggatactccatctggcatc
aaagattctattccggcatggattaaattctcagtgcaggcaccgggtgaaatcccatat
aatggcatatactatgatccaccggaggaggaaaagtacgtgttcaaacattctcagcca
aagaggccaaaatcactcaggatttatgaatcacatgttggaatgagtagtacggaacca
attattaacacgtatgccaattttagagatgatgtacttcctcgcatcaaaaggcttggt
tataatacggtccagatcatggctattcaagagcattcatattatgctagttttgggtac
catgtaactaattttttcgcacctagcagccggtttggaactcctgatgacctgaagtct
ctgatagataaagctcatgagttagatctgcttgttctcatggatattgttcatagccat
tcatcaaataatacgttggatggcctgaacatgtttgatggtactgatggtcactacttt
cactctggatcacggggttatcattggatgtgggactctcgccttttcaactatggaagc
tgggaagtactaaggtttcttctttcaaatgctcgatggtggctggatgagtataagttt
gatgggttcagatttgatggagtgacttcaatgatgtacactcaccatggattagaggta
gcttttactggcaactataatgagtactttgggtttgcaaccgatgtagatgctgtggtt
tacttgatgcttgtcaatgatatgattcacggtctattccctgaggctgtcaccattggt
gaagatgttagtggaatgccaacattttgcatccctgttgaagatggcggtgttgggttt
aattaccgtctccacatggccattgccgataaatggattgagttgctccagttgaaggat
gaagactggaaaatgggtgacattgtgcatacacttaccaatagaaggtggatggaaaat
tgtgttgcctatgctgaaagtcatgaccaagctcttgtcggtgacaaaaccattgccttt
tggttgatggacaaggatatgtacgacttcatgtctcttgatagaccatctactcctctc
attgatcgtggaatagcattgcataaaatgatcaggcttgctaccatgggattaggtgga
gaaggatatttgaattttatgggaaatgaatttgggcatcctgagtggattgattttcca
agaggtgatcaacatcttcctagcggaaaaataattccggggaacaatttcagttatgat
aaatgccggcgtagatttgatctaggggatgcagactatctaagatatcatggaatgcaa
gaatttgatcaggcaatgcagcatcttgaagaagcctatggtttcatgacttctgagcac
caatatatatcacggaaggatgaaggggatcgtatcattgtcttcgagaggggcaacctt
gtttttgtcttcaattttcattggaataacagctattcggattaccaagttggctgctta
aagcctggaaagtacaagattgtcttagattcagataattccttgtttggaggcttcagc
aggattaatcatagtgccgagtacttcagctttgaagggtggtatgataaccggcctcga
tccttcttggtgtatgcaccaagtagaacagcagtggtctatgctttagtggaggatgaa
aaagaacatttacaggacgccgacgacaacaaaaacaacaacagcgagcatgaggaacct
gtcaatggctga

DBGET integrated database retrieval system