KEGG   Ricinus communis (castor bean): RCOM_0070960Help
Entry
RCOM_0070960      CDS       T01087                                 

Definition
phosphofructokinase, putative (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_0070960
   01230 Biosynthesis of amino acids
    RCOM_0070960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0070960
   00030 Pentose phosphate pathway
    RCOM_0070960
   00051 Fructose and mannose metabolism
    RCOM_0070960
   00052 Galactose metabolism
    RCOM_0070960
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RCOM_0070960
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RCOM_0070960
Protein phosphatases and associated proteins [BR:rcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RCOM_0070960
Messenger RNA biogenesis [BR:rcu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RCOM_0070960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 431 aa AA seqDB search
MRTPVTEDFANGYPSDEEWHGYINNNDRVLLKVIHFSSPTSAGAECIDPDCTWVEQWVHR
AGPREKIYFKPEEVKAAIVTCGGLCPGLNDVIRQIVITLEIYGVKKIVGIPFGYRGFSDN
DLSEMPLSRKVVQNVHLSGGSLLGVSRGGPDVSDIVDSMEERGINMLFVLGGNGTHAGAN
AIHNECRKRRLRVAVVGVPKTIDNDILLMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGI
GIVKLMGRSSGFIAMHASLASGQIDICLIPEVPFHLHGPHGVLNHLKYLIETKGSAVVCV
AEGAGQSFLQKTNATDASGNIVLGDFGVHLQQETKKYFKEIGVHADVKFIDPTYMIRACR
ANASDGILCTVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISYPRAVDPNSRMWHR
CLTSTGQPDFI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccagttacagaggattttgcaaatggttatccatctgatgaggagtggcat
ggttatattaacaataatgatagggtgcttttgaaggtcatacatttctcatctccaaca
tctgcaggagctgagtgcattgatcctgattgtacttgggttgaacaatgggttcatcga
gctgggcctcgggagaaaatatacttcaaaccagaagaagtaaaggcagcaatcgtaact
tgtggggggttatgccctggtcttaatgatgttatcagacagattgttattacacttgag
atttatggtgtgaaaaagatagtggggattccttttggctatcgaggattttcagacaat
gacttgagtgaaatgccgctatcaaggaaagtagttcaaaatgttcatctttctggtgga
agcttgttaggagtttcacgtggagggcctgatgttagcgacattgtggacagtatggag
gaaagaggaatcaacatgctttttgtgttaggtgggaacggcacccatgctggagcgaat
gcaatacacaacgagtgtcgtaaacgaaggttgagagtggctgtagttggtgtaccgaaa
actatagacaatgatattttgttgatggataaaacttttggtttcgatactgctgttgaa
gaagcacaacgggcaataaactctgcatatattgaggcacatagtgcttatcatggcatt
gggatagtgaaattaatgggtcgtagtagtggatttatagccatgcatgcatccctagct
agcggccaaatcgacatttgtttgattccggaggtacctttccatttacatggtcctcat
ggtgttctgaatcacttaaaatacctaattgagacgaaggggtcagctgtcgtctgtgta
gcagagggagctggacagagttttcttcagaaaactaatgctactgatgcgtcaggaaac
attgtacttggagatttcggggtacaccttcaacaagagacaaagaaatattttaaggag
attggtgttcatgcggatgtgaagtttattgatccaacatacatgatccgtgcatgtcgt
gcaaatgcatcggatggaatcttatgtactgttcttggacaaaatgccgtccatggtgca
tttgctggatatagcggaatcactgttggcatatgtaacactcactatgtctactttcct
attcctgaagttatttcttatccccgggctgtagatcctaacagccgcatgtggcatcgt
tgcttgacttcaacaggccagcctgactttatctaa

DBGET integrated database retrieval system