KEGG   Ricinus communis (castor bean): RCOM_0077940Help
Entry
RCOM_0077940      CDS       T01087                                 

Definition
Xylose isomerase, putative (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCOM_0077940
   00051 Fructose and mannose metabolism
    RCOM_0077940
Enzymes [BR:rcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RCOM_0077940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 477 aa AA seqDB search
MKGGWILLLLLCLNTVTSGVIAAGPPTCPADLGGKCADSDEWKGEFFPGIPKIKYEGPSS
KNPLAYKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGADPFGAPTKYWPWEDGTDSLAM
AKRRMRANFELLDKLGVDRWCFHDRDIAPAGKTIEESNANLDEVVALAKELQGTKILPLW
GTAQLFLHPRYMHGAATSSDVGVYAYAAAQVKKAIEVTHYLGGENYVFWGGREGYQSLLN
TDMERELDHMARFMEAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGL
IDEFKLNIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDIAEAT
LVMMSVIRNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRNAAKLIEDGSL
AELVRKRYESFDTEIGAQIEAGKADFEMLEKKAIEWGEPKVPSAKQELAEMIFQSAL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtgggtggatactgttgcttctcctttgcttgaatacagtcacttctggtgtg
attgctgctgggccaccaacatgccctgctgatcttgggggcaaatgtgctgattcagat
gaatggaaaggggaattcttccctggcattcccaaaattaaatacgagggtccttctagc
aagaatccacttgcatataaatggtataatgcagaagaggagattctggggaagaaaatg
aaggactggatgagatttagcattgcattttggcatacattccgcgggacaggagctgac
ccgtttggtgcaccaactaaatattggccttgggaggatggtactgattcattggctatg
gccaaaagaagaatgagagctaattttgagttactggacaagctgggagttgacagatgg
tgtttccatgatagggatatagccccagctggaaaaactattgaggaaagtaatgcaaac
ttggatgaagtggtggcccttgcaaaagaactccaaggaaccaagatacttcctttatgg
ggcacagctcagttgtttttacatcctcgttacatgcatggtgctgcaaccagctctgat
gtaggtgtatatgcatatgctgcagctcaagttaagaaagcaatagaggtcacacattac
ttaggtggagaaaattatgtcttttggggcggtcgtgaggggtatcagtctcttttaaac
acagatatggaaagggagcttgatcatatggcaagatttatggaagcagctgttgcctac
aagaagaagattggattcaatgggactctgctaattgagcccaaaccacaagagcctact
aaacaccagtatgattgggatgctgccacagcagctaatttcttgcgaaaatatgggctt
atagatgaatttaagctcaacattgagtgcaatcatgccacgctttctggtcacagctgt
catcatgagctagaaactgcaagaatcaatggtttgctaggaaatattgatgccaacact
ggcgatcctcagattggatgggatacagatcagttcatgacagatattgcagaggcaact
cttgttatgatgagtgtgattagaaatggaggactggcaccaggaggattcaattttgat
gcaaaattgcgaagagaaagtacagatgttgaggatattttcattgctcatattggtgga
atggataccttggctcgtggactccgaaatgctgctaagttgattgaggatggttctttg
gctgagcttgtccgcaaacgctatgagagttttgacacagaaatcggagcacaaatagag
gctggtaaggctgattttgaaatgcttgagaagaaagccatcgagtggggagaacctaaa
gttccttctgccaagcaggaacttgcagagatgattttccagtccgcactgtag

DBGET integrated database retrieval system