KEGG   Ricinus communis (castor bean): RCOM_0085180Help
Entry
RCOM_0085180      CDS       T01087                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative (EC:1.3.99.5)
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    RCOM_0085180
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     RCOM_0085180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MAFSDGSLFHKSLLALYLIGPPTFISLKFLQAPYGKHNRPGWGPTISPPLAWFLMESPTL
WLTFLLFPFGQHASNPKAWVLMFPYLFHYFHRTCLYPLRLYWNTNQRNTKITSGFPVSMA
LLAFLFNFLNAYLQARWVSHYKEDYDQDRWFWWRFWGGLVVFAWGMWTNVWSDRVLVRLK
REGDGYKVPRGGLFDLVSCPNYFGEIVEWLGWTLMTWSWVGFGFFLYTSANLVPRAVANH
KWYLDKFGKDYPRGRKAVIPFLY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttctcagatggaagcctctttcataaaagcctcctagctctctacctcataggg
ccccctaccttcatctccctcaagttccttcaagcaccgtatggaaaacacaaccgccct
ggatggggccccaccatctcgccacctttggcctggttcctcatggagagccccactctc
tggcttacatttttactcttcccttttggccaacatgcttccaatcccaaagcttgggtt
cttatgttcccttatctcttccattatttccaccgcacctgtctctaccctctacgcctt
tactggaatacaaatcagcggaataccaaaatcactagcggttttcctgtgagcatggcc
cttctggcatttttgttcaacttcttgaatgcttacttgcaagccaggtgggtatctcat
tacaaggaggattatgaccaggataggtggttctggtggaggttttggggtgggctagtg
gtgtttgcgtggggtatgtggactaatgtatggtcggacagggttttggttcggttaaag
agagaaggtgatgggtataaggtgccaagaggagggttgtttgatctggtgagctgcccc
aactactttggtgagattgtggaatggcttggttggactctgatgacatggtcctgggtt
gggtttgggttttttctctatacatctgccaacttggtgccgagggcagtggctaaccat
aagtggtatctggacaagtttggaaaggattatccaagaggtagaaaagctgtcatccct
ttcttgtattga

DBGET integrated database retrieval system