KEGG   Ricinus communis (castor bean): RCOM_0120900Help
Entry
RCOM_0120900      CDS       T01087                                 

Definition
histone-lysine n-methyltransferase, suvh, putative (EC:2.1.1.43)
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rcu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MIGSVPGVEVGDEFQYRVELNIIGLHRPTQGGIDYMKEGGLILATSIVASGGYDDNMDDS
DVLIYTGSGGNMMNGGDKEPEDQKLERGNLALKNSMDAKNPVRVIRGDTRASESSSARTR
TYIYDGLYLVEKCWQDLGPYGKLVFKFRLVRIPGQPELAWKVVKKSKKFKVRDGLCEDDI
SKGKEKIPICAVNTIDDEKPPPFEYITHVIYPDWCRPIPPRGCNCTNGCSETAECSCVAK
NGGEIPFNHNGAIVEAKPLVYECGPSCKCPPSCYNRVTQHGIKIHLEIFKTESRGWGVRS
LNSIPSGSFICEYVGELLEEKEAEQRAGNDEYLFDIGNNSSDLWDGLSNLISETHSSSCE
VVEESCFTIDAAKYGNVGRFVNHSCSPNLYAQNVLYDHEDKRVPHIMLFAAENIPPLQEL
TYHYNYTIDEVFDSDGNIKKKSCYCGSSECTGRMY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctcagttccaggcgttgaagttggtgatgagtttcaataccgggtggagctt
aatattattggtcttcatcgcccaactcagggaggtatagattatatgaaggaaggtgga
cttatccttgctaccagtattgtagcatccggtggctatgatgacaatatggatgattca
gatgtattgatatacacaggttcaggggggaacatgatgaacggaggagataaggaacct
gaagaccagaagcttgaacgaggtaatcttgctttgaagaatagtatggatgcaaagaat
cctgtaagggtcatccgtggtgatacaagagcatctgaatcatccagtgcaagaactagg
acatatatctacgacgggttatatttggtggagaagtgttggcaggatttgggaccatat
ggtaaactagtctttaagtttagattggttcgaattccaggacaaccagagcttgcttgg
aaagtggtgaagaagtccaaaaaatttaaagtacgagatggtctctgtgaggatgatatc
tcaaaaggaaaagaaaaaattcccatttgtgctgtaaacaccatagatgatgagaaacct
ccaccatttgaatacattactcacgtgatatatcctgattggtgccgccctattcctccc
aggggttgtaattgcactaatggatgctctgagactgcggaatgttcttgtgtggcaaag
aatggaggagagatcccatttaaccataacggggctattgttgaagcaaaacctctggtg
tatgagtgtggcccttcttgcaagtgtcctccttcttgttacaacagagtcacccagcat
ggtattaagattcaccttgaaatttttaaaaccgaatcaaggggttggggtgtgagatct
ttaaattcaatcccttcaggaagttttatctgtgagtacgtaggggagcttcttgaagag
aaggaagctgagcaaagagctggtaatgatgagtatttatttgatattggaaataactct
agtgacctatgggatggactttcgaacctcatatctgagacccattcaagttcttgtgag
gttgtggaggagagttgcttcaccattgatgcagcaaagtatggcaatgttgggagattc
gtcaaccatagctgttcacctaatctctatgcgcaaaatgttctctatgatcatgaggac
aagagagttcctcacataatgctgtttgctgctgaaaatattcctcccttgcaagagcta
acttaccattacaactatacaatagatgaggtttttgactctgatggcaatattaagaag
aagagttgctactgtggttcttctgagtgcactgggagaatgtattga

DBGET integrated database retrieval system