KEGG   Ricinus communis (castor bean): RCOM_0138590Help
Entry
RCOM_0138590      CDS       T01087                                 

Definition
alcohol dehydrogenase, putative (EC:1.1.1.284)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RCOM_0138590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0138590
  Lipid metabolism
   00071 Fatty acid degradation
    RCOM_0138590
  Amino acid metabolism
   00350 Tyrosine metabolism
    RCOM_0138590
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RCOM_0138590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MSSTVGQVIRCKAAVAWEAGKPLVIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ
APLFPRIFGHEASGIVESVGPGVTDLQPGDHVLPVFTGECKECRHCKSEESNMCDLLRIN
TDRGVMLTDGNSRFSINGKPIYHFLGTSTFSEYTVVHVGCVAKINPEAPLDKVCVLSCGI
STGLGATLNVAKPKKGQSVAIFGLGAVGLAAAEGARLCGASRIIGVDLNPSRFEEAKKFG
VNEFVNPKDYDKPVQQVLAEMTDGGVDRSVECTGSIQAMISAFECVHDGWGVAVLVGVPN
KDDAFKTHPVNLLNERTLKGTFFGNYKPRTDLPSVVEKYMNKELEVEKFITHSVKFSEIN
KAFDYMLKGESLRCIISMEN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcacagttggtcaggtcattcgttgcaaagctgcggttgcatgggaggcaggg
aagccactggtgattgaagaagtggaggtggcaccgccacaggctaatgaagttcgtttg
aagatcctcttcacctctttatgccacactgatgtttacttctgggaagctaagggacaa
gcaccattattccctcgcatatttggtcatgaagctagtggtattgtggagagtgttggt
cctggtgttactgatctccaacctggcgatcatgtgcttcctgtgttcactggggagtgc
aaggagtgccgtcattgcaaatcagaagagagcaacatgtgtgacctcctcaggatcaat
actgataggggtgtgatgctcactgatgggaactcgaggttttctattaatgggaagcca
atataccactttctgggcacctctacattcagtgaatacactgttgtccatgttggctgt
gttgccaagatcaaccccgaagctcctcttgacaaagtttgtgttctcagttgtggaata
tcaacaggtcttggtgccactttgaatgttgcaaaacccaagaagggtcagtctgtagcg
atttttggactaggtgctgttggactagctgctgcagaaggggcaaggttatgtggagct
tcaagaatcattggtgttgatttgaatcccagtcgttttgaagaagccaagaagttcggt
gttaacgagtttgtgaatccaaaagattatgacaagcctgttcaacaggtacttgctgag
atgactgatggaggagttgatcggagtgttgaatgcactggaagtatccaagccatgatc
tcagcttttgaatgcgtccatgatggctggggtgttgctgtattagtgggcgtccctaac
aaggacgatgcgttcaaaactcatcctgtgaatctgctgaacgagagaactttaaaagga
accttcttcggcaattacaagccccgcactgatcttccttctgttgtggaaaagtacatg
aacaaggagctagaggtggagaaattcatcactcacagtgtgaaattctcggagattaac
aaagcatttgactacatgctgaagggagagtctctgaggtgcattatttccatggagaac
tag

DBGET integrated database retrieval system