KEGG   Ricinus communis (castor bean): RCOM_0191600Help
Entry
RCOM_0191600      CDS       T01087                                 

Definition
Ubiquitin carboxyl-terminal hydrolase isozyme L3, putative (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     RCOM_0191600
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   RCOM_0191600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MATIDESPSAKRWLPLEANPDVMNQFLWGLGVVESEAECYDVYGLDEELLEMVPKPVLAV
LFLYPITPQSEEERLQQEGVKQEPSNKVYFMKQTVGNACGTIGLLHAVGNITSEINLVEE
SFLDRFFKSTARMDPMERATFLENDREMEVAHSVAATGGDTEASDNVDTHFICFTCVEGK
LFELDGRKSGPISHGASSQGSLLQDAAKVIRDMIQKNPDSLNFNVIAISKKAEGAF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatagacgaaagtccctctgctaaacgctggcttcctcttgaagctaatcca
gatgttatgaaccagtttctttggggattaggtgtggtcgagagtgaagcagagtgttat
gatgtttatggtttagatgaggaacttttggaaatggttccaaagcctgtccttgctgtg
ctttttctctatccgattactcctcagagtgaagaggaaagattgcagcaggaaggtgtg
aaacaagaacctagcaataaagtttatttcatgaaacaaactgtgggtaatgcctgtggc
acaatagggcttcttcatgctgttgggaacatcacttctgagattaatcttgtcgaggaa
tcattcttggataggtttttcaaatccactgcaagaatggatccaatggagcgtgctaca
tttcttgagaatgacagagagatggaagttgctcattctgtggcagccacaggtggtgat
acagaggcttcagacaacgtggacactcattttatctgtttcacatgtgtggaagggaaa
ctttttgaacttgatggaagaaagtcaggaccaatatcgcatggtgcatcctcacaaggc
agcttattgcaggatgcagccaaagtcataagggacatgatccagaagaatccggattcc
ctcaactttaatgttattgccatttcaaagaaagctgagggtgcattttaa

DBGET integrated database retrieval system