KEGG   Ricinus communis (castor bean): RCOM_0204880Help
Entry
RCOM_0204880      CDS       T01087                                 

Definition
Replication protein A 30 kDa subunit, putative
Orthology
K10739  
replication factor A2
Organism
rcu  Ricinus communis (castor bean)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:rcu03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:rcu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rcu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rcu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MFSSSQFESFSGGGFMSSQSSQPTDSAPSPAKSRDSQGLVPVTVKQISQASHSGDENSNY
VIDGVDVTNVTVVGMVFDKAQKVTDVNFTVDDGTGRIGCKRWVNENFDSSEMETIQDGMY
VRVSGHLRSFQGVRQLGAFSVRPVMNFDEVTFHFIDCIHTHLLNSKSQFTKQYSVDGLKD
CDQLVLDYLQQSSSMGQEKGIHMDELSQQLKLPMDKIKETIRSLEDEGLIYSTIDEFHYK
AT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttctccagcagccaattcgaatccttttccggcggtggatttatgtcttcgcagtca
agtcagccaaccgattcggctccatcccctgcaaaaagtcgtgattctcagggtttggta
ccggtaacagtgaagcagataagtcaggcttctcattctggtgatgaaaattcaaattac
gtgatcgatggcgtggatgtgaccaacgttactgtggttgggatggtgtttgataaagct
caaaaggtaaccgatgttaatttcaccgtggatgacggaacaggccgaattggttgtaaa
agatgggtgaacgagaattttgacagctcggaaatggagacgatacaagatggaatgtac
gttcgtgttagtgggcatctgagaagttttcaaggcgtaagacagttgggtgctttctct
gtgaggccagtaatgaactttgatgaggttactttccactttattgactgcatacacacc
catttgctgaactctaagtcacagttcaccaagcaatacagcgttgatggactaaaggac
tgtgatcaactggtcctcgactatctgcaacaatcttcaagcatggggcaggaaaagggg
atacacatggatgaacttagccagcagctaaagcttcccatggataagatcaaggaaact
attagatctctcgaagatgaaggcctgatatactctacaatcgatgaatttcactataaa
gcaacctga

DBGET integrated database retrieval system