KEGG   Ricinus communis (castor bean): RCOM_0223370Help
Entry
RCOM_0223370      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:rcu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1270 aa AA seqDB search
MVSPKQLHSIVESSLFSSSSPSPAQRIELLHALRSSLPSLQNLLSYPPPKPSDRAQVQSK
EVRLPDSPPIPLDDQDVQIALKLSDDLHLNEIDCVQLLVSANQEVDLSFLSLLSLYLRHM
HQKWNLISDCQLLFLFVVGFNGTRAIRNFAPCSRLWYTERRDLITALYIILRAVVLDQGL
EPDLVLDIQKCLEDLISGGLRQRLISLIKELNREEPAGLGGPLCDHYVLDSRGALSERRA
VVHKERHLLGHCLVLSVLVVRISSKDVKDVIYTLKDSASELVEVNGTLKHQAFIILFSLQ
IAFCLLFSLVIAFMSDALSALPDKASILSCDASFRKEFHEILMATENDPVVEGFIGGVRL
AWSVHLMLINDVITAREEVSNASSTDLGYLNSSLELIFSRNVFQFLLDNVLRTAAYQVKD
SKENAMSVLNSYRLAASHDSKLHSQQASETGPSPFVSLMEFVSEIYQVIENGHPAERKNW
FSDIEPLFKLLSYENVPPFLKGALRNAITTFIHVSPVLKDTIWSYLEQYDLPLVVGTRVV
NSGKPMTAQVYDMRYELNEIEARIERYPSTISFLNLLNVLIAEEKDVSDRGRRAYADSCE
KWQLVVACLQHFHMMLSMYGIQDEDIDSVVDRSLTQPSSLEMQLPVLELLKDFMSGKAVF
RNLMGILLLGVNFIMTERTSQIHGQLLEKAVQLSLEIIILVLEKDLVVSDYWRPLYQPLD
VILSQDHNQIVVLLEYVRYDLLPQIQLCSIKVMTILSSRMIGLVQLLLKSNAASCLVEDY
AACLELRSEECQIIENSANDSGILIMQLLIDNISRPAPNITHLLLKFDLDTPVERTVLQP
KFHYSCLKIILEILEKLSKPEINALLHEFGFQLLYELCLDPLTCGPTMDLLSNKNYQFFV
KHLDTIGVAALPKRNSNQPLRISSLHQRAWLLKLLAVELHSGDMGSPTHKEACQNILSHL
FGREIIDIGSDRVASNAMTLRNGTEHAGAQAISKSKVLELLEVVQFRYPDTTVKLSQIVS
NMKYDLLAEDILEDTTASGKGSIYYYSERGDRLIDLGSFRDKLWQKFNSVYPQLSNFGSE
AELNDVREAIQQLLRWGWKYNKNLEEQAAQLHMLTGWSQIVEVHCLSWIHFDCQYALLLS
YFQYCRHTLDPDVPTAVLQFLLLNEHDSEDLHKIDREQAELARANFSILRKEAQSILDLV
IKDATQGSGPGKTIALYVLDSLICIDHDSYFLSQFQSREFLRGCLMSISNVSYQVLLHHN
IYRLMGRICF
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctccaaagcaactccattcgatagtcgaatcttctttattcagttcgtcgtct
ccgtcaccggcgcagagaatcgagctcttgcacgcccttcgaagctctctcccttctctc
cagaaccttctctcctacccgcctcctaaaccttcggaccgtgctcaagttcagtcaaaa
gaagttaggttaccagattcaccgccaattccattagatgatcaggatgttcagattgct
ttgaaattgagtgatgacctccatctcaacgaaatagattgtgttcaattgcttgtttct
gccaaccaagaggtggatctctcttttctttctttgttgagtttatacttaaggcatatg
catcagaaatggaatcttatttctgattgtcaattgctcttcttatttgtagtggggttt
aatgggacgagagccattagaaattttgcgccttgcagcagactttggtacactgagaga
cgggatcttataacggctctatacattatcttaagggctgttgtacttgatcagggactt
gaaccggaccttgttttagacattcagaagtgtctagaagatcttataagtggcgggctt
aggcagcgtttgatttctctaataaaggaactcaatcgagaagagcctgccggtttaggt
gggcctctatgtgaccactatgtcctcgactctagaggtgctcttagtgagcggcgagct
gtggttcataaggagagacatttgctcggacattgccttgtcctgtctgttttggttgtg
cggataagctcaaaagatgtaaaggatgttatctataccttaaaagatagtgcttctgag
cttgtggaggtcaatggcactctaaaacatcaggcatttatcattcttttctctttgcag
attgcgttctgtcttcttttcagtcttgtcattgctttcatgtcagacgccctgagtgca
ttacctgataaagcatctattctgtcttgtgatgcttcctttagaaaagaatttcatgaa
attctgatggcaactgagaatgatccagttgtggagggcttcattggtggtgtaaggctt
gcttggtctgtacatctgatgttaataaatgatgtgattactgcaagggaagaagtttca
aatgcttcatcaactgatttgggctacctaaattcaagcctggaactcatattctcgagg
aatgttttccagtttttactggataatgttcttcgcactgcagcttatcaggtaaaagat
tcaaaggagaatgcaatgagtgtgcttaattcatatcgattggctgcttcacatgatagc
aaattgcattctcaacaggccagtgaaactggcccttcaccatttgtatctctgatggag
tttgtgagcgaaatatatcaggttatcgaaaatggacatcccgctgaaagaaagaattgg
ttttctgatattgaaccattgttcaagctccttagttatgagaatgtacctccttttctg
aagggtgccttgcggaatgccataactacatttattcatgtctctccagtcctaaaagac
accatttggagttacctagagcagtatgatttgccattagtagttggcactcgtgttgta
aatagtggaaaaccaatgacagctcaggtttatgatatgagatatgagttgaatgaaata
gaagcaaggatagaaagatatccatcaacaatttcttttcttaacctattaaatgtcctt
attgcggaggaaaaagatgtaagcgatagagggcgtagagcctacgctgattcgtgtgag
aaatggcagttagttgttgcttgtcttcagcattttcatatgatgctgagcatgtatggg
atccaggatgaggacattgacagtgttgttgatcggtcactgacacagccatcttcactt
gaaatgcagcttcctgtcttagagttgctaaaagatttcatgagcgggaaggcggtattc
cgcaatcttatgggcattcttctgctaggggtcaatttcataatgacagaacgcaccagt
caaattcatgggcaacttctagaaaaggcagtgcaactttctttggaaattatcatcctt
gtcctggaaaaagatctagttgtttctgattactggcgtcctctgtaccagcccttggat
gttatactgtctcaggatcataatcaaattgtggtgttgttggagtatgtcagatatgat
cttctacctcaaattcagctatgctctatcaaagttatgaccattctgagttctcgcatg
atcgggcttgtacagttactgttaaagtccaatgctgcaagctgtttggttgaggattat
gcagcctgtcttgagctacgttcagaagagtgccagattatagagaacagtgctaatgac
tcgggaattctaataatgcaacttctgatagataatattagtaggccggctccaaatatt
acacatttactgctcaagtttgatctcgacaccccagttgaaagaacagttctgcagcca
aaatttcactacagttgcttgaagattattcttgaaatcttggagaaactctcaaaacca
gaaataaatgcattactccacgagtttggttttcagctcctttatgagctgtgcttggat
ccactaacatgcggccctaccatggatttgttaagcaacaaaaattaccaattctttgta
aagcatcttgatactattggtgttgctgcccttcctaaacgaaatagcaaccagccactt
cgcatcagttctcttcaccagagagcatggctcttgaagcttttagctgtagagttgcat
tctggtgatatgggtagccccactcacaaagaagcctgtcagaacatactttctcatctt
tttggaagggaaataattgacattgggtctgatcgtgtggcttctaatgcaatgactctt
cgaaatggaactgaacatgctggagcacaagcaataagcaagagtaaggtattagaattg
cttgaggtggtccagtttagatatccagatactactgtgaagctttctcagatcgtctct
aatatgaaatatgacttgctggcagaggacatacttgaagatacaacagcatctggaaag
ggcagcatctattattattctgagcgtggtgatcgtttgattgacctaggttctttccgt
gacaaactttggcagaaattcaattcagtgtatccccagctgagtaactttggcagtgaa
gctgaacttaatgatgtaagggaggcaattcagcagttgttaagatggggatggaagtat
aataaaaaccttgaggaacaagctgcccaacttcatatgttaactggctggtcacagatt
gtggaggtccactgtctttcttggattcattttgattgccaatatgccttgctacttagt
tattttcagtattgccggcatacacttgatccagatgttccaacagcagttctgcaattc
ttgttgcttaatgaacatgatagtgaagatctccataagattgacagagaacaggcagaa
ttagcccgtgctaatttttccatattaagaaaagaagctcagtcaatcttggatttggta
ataaaggatgcaacacaaggcagtggaccagggaagacaatagcactttacgtccttgat
tcattgatttgtatcgaccacgatagctactttttaagccaatttcaaagtagggaattt
ctgcgtggttgcctgatgagcatcagcaacgtttcatatcaggtgttgcttcaccacaat
atctaccgattgatgggcagaatatgtttctaa

DBGET integrated database retrieval system