KEGG   Ricinus communis (castor bean): RCOM_0236080Help
Entry
RCOM_0236080      CDS       T01087                                 

Definition
alcohol dehydrogenase, putative (EC:1.1.1.284)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rcu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rcu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rcu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rcu00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MACSAGQVIRCKAAVAWEAGKPLLIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ
NPLFPRIYGHEAGGIVESVGEGVTDLKPGDHVLPVFTGECKECAHCKSEESNMCSLLRIN
TDRGVMLNDGNSRFSINGKPIYHFVGTSTFSEYTVVHVGCLAKINPLAPLDKVCVLSCGI
STGLGATLNVAKPAKGSSVVVFGLGAVGLAAAEGARIAGASRIIGVDVNSSRFEEAKKFG
VTEFVNPKDYKKPVQEVIAEMTDGGVDRSVECTGNIDAMISAFECVHDGWGVAVLVGVPH
KDAVFRTHPVNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELELEKFITHSVPFSEIN
KAFEYMLKGEGLRCIIRMEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcatgctctgctggccaagttatacgttgcaaagctgctgtggcatgggaggctggg
aagccactactgatagaagaagtggaggtggcacctccacaggctaacgaagttcgtctg
aagatcctgtttacctctttatgccacactgatgtttacttctgggaagccaagggacaa
aatcctttatttcctagaatatatggtcacgaggctggagggattgtggagagtgttggc
gagggtgtgacagatctcaaaccaggagaccatgtactccctgtgttcacaggggaatgc
aaggaatgtgctcattgcaaatcagaggaaagcaacatgtgtagcctcctcaggataaat
actgataggggtgtaatgcttaatgatggcaattcaagattctcaatcaatggcaagccc
atttatcactttgttgggacctccacctttagtgagtacactgtggttcatgttggctgt
cttgccaagatcaaccccttggctcctcttgataaagtctgcgtgctcagttgcggaatc
tccacaggtctcggtgctaccctcaatgttgcaaagcctgcaaagggatcatcagtggtt
gtgtttggactgggagctgtaggccttgctgctgctgaaggggctagaatcgctggggct
tcaaggattataggtgttgatgtgaactcgagtaggttcgaagaagctaagaaatttggc
gtgactgagtttgtgaatccaaaggactacaagaaaccagttcaagaggtgattgctgag
atgactgatggaggagtggacagaagtgttgaatgcacaggaaacattgatgccatgatc
tccgcattcgaatgtgtacatgatggctggggagttgcagtgcttgtaggggtgccccac
aaagatgctgtcttcaggactcaccccgtgaatttactaaacgaaaggactcttaagggc
accttctttggaaactacaaacctcgctctgacctcccttcagttgtagagaaatacatg
agcaaggaacttgaattggaaaagttcatcacacattcagtaccattttctgagatcaac
aaggcctttgaatacatgcttaaaggtgaaggccttcgatgcattattcgcatggaggaa
taa

DBGET integrated database retrieval system