KEGG   Ricinus communis (castor bean): RCOM_0242360Help
Entry
RCOM_0242360      CDS       T01087                                 

Definition
cytochrome P450, putative (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RCOM_0242360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 694 aa AA seqDB search
MQPSSSSAGSIMKVSPFDLISAVIKGNLDPSNVSSESSAVEVATMLYENREFVMILTTSI
AVLIGCVVVLVWRRSGSQKSKSVAIEPLKPLVVKEPEPEPDDGQKRVTIFFGTQTGTAEG
FAKALSEEAKARYEKATFKVVDLDDYAADDDEYETKLKKESLALFFVATYGDGEPTDNAA
RFYKWFTEGKERGEWLQDLKFGVFGLGNKQYEHFNKIAKVLDELLEEQGAKRLVPVGLGD
DDQCIEDDFTAWKESLWPELDQVLRGEDDAATVSTPYTAAVLEYRIVFYDPEDAPIEDKR
WSNTNGHAVYDAQHPCRANVAVRKELHTPASDRSCTHLEFDIAGTGLSYETGDHVGVYCE
NLDETVEEALQLLGLSPDTYFSIHADKEDGTALSGSSLPAPFPPCTLRTALTRYADLLSS
PKKSALLALAAHATDPTEADRLRHLASPAGKDEYTQWIVAAQRSLLEVMAEFPSAKPPLG
VFFASVAPRLQPRFYSISSSPRMAPSRIHVTCALVLDKTPTGRVHKGVCSTWMKNSVPME
KSHECSWAPIFVRQSNFKLPADTKVPIIMIGPGTGLAPFRGFLQERLALKEAGVELGPSV
LFFGCRNSKMDYIYEDELNNYVESDALSELIVAFSREGPTKQYVQHKMSEKALDIWNMIS
QGGYIYVCGDAKGMARDVHRTLHTIVQEQVSFFT
NT seq 2084 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatcatcatcatcggcaggttccatcatgaaggtatcgccttttgatctgata
tcagccgttattaaaggcaacttagacccgtctaatgtatcatcagaatcaagcgctgtt
gaggtggccactatgttatatgagaaccgtgagtttgttatgattttaactacttccatc
gcggttttgatcgggtgtgttgtggtgttggtgtggagaagatccggcagtcagaaatct
aagtcggttgctattgaacctcttaaaccgttggttgttaaagagcctgagcctgaacct
gacgatggccagaaacgtgtcaccattttttttggtactcagaccggtacagctgaagga
ttcgctaaggctttgtctgaagaggcaaaagctcgatatgaaaaggcaacttttaaagtt
gttgatttggatgattatgcagctgacgacgatgaatacgagacgaaattaaagaaagaa
tctttggctttgttttttgttgctacatatggagatggtgagccaacagataatgccgcc
agattctataaatggtttactgagggaaaagagagaggggaatggcttcaggaccttaag
tttggagtgtttggccttggcaacaagcaatatgagcattttaataagattgctaaggtg
ttggatgaactccttgaagagcagggtgcaaagcgtcttgtcccagtgggtcttggggat
gatgatcaatgcattgaagatgacttcactgcttggaaagaatcactctggcccgagtta
gatcaggtccttcggggtgaggatgatgcagcaactgtttctaccccatatacagctgct
gttttggaatatcgtattgtattctatgatcctgaagatgcacctatagaggacaaaagg
tggagtaatacaaatgggcatgctgtttatgatgcacagcatccatgcagggcaaatgtt
gctgtgagaaaggagcttcacacacctgcatctgaccgttcctgcacccatttggagttt
gacatagctggcactggactttcgtatgaaactggggatcatgtaggtgtatactgtgag
aatcttgatgaaactgtagaggaggcattgcagttattgggtttgtcaccggatacttat
ttctctatccatgctgacaaagaggatggtacagcacttagtggaagctccttgcctgct
cctttcccaccatgcaccctaagaacagctctcactagatatgctgatctgttgagttca
ccaaaaaagtctgctttacttgctttagcagctcatgctactgatccaactgaagctgat
agactaaggcatcttgcttcacctgctggaaaggatgaatatacacaatggatagttgct
gctcaaagaagcctccttgaggtcatggctgaatttccatcagccaagcctccacttggt
gtcttctttgcttcagtggctcctcgtttgcaacccagattctattctatttcatcatcc
ccaaggatggctccatctagaattcatgttacttgtgcactggttcttgacaaaacacca
acaggacgggtacacaaaggagtatgctcaacatggatgaagaattctgttcctatggag
aaaagccacgaatgcagttgggcacccatttttgttaggcagtcaaactttaagcttcct
gcagacaccaaagtgcctatcattatgattggccctgggactggtttggctcctttcagg
ggtttcttgcaggaaagactagctctgaaagaagctggtgtggaattgggaccctccgta
ttatttttcggttgcaggaatagtaagatggattacatctatgaggatgaactcaacaac
tatgtcgaaagcgatgcactttctgaactgattgttgccttctcccgagagggacctacc
aagcaatatgtacaacataaaatgtcggagaaggctttagatatatggaacatgatttct
cagggaggatatatatatgtctgtggtgatgccaaaggcatggccagggacgtccacaga
acacttcacactattgtccaagagcaggtaagcttttttactga

DBGET integrated database retrieval system