KEGG   Ricinus communis (castor bean): RCOM_0261790Help
Entry
RCOM_0261790      CDS       T01087                                 

Definition
protein disulfide isomerase, putative (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:rcu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 433 aa AA seqDB search
MRSLVVTISILSLLISVSQSSEESNEKFKVDGKVLELDESNFDLAISSFDFIFVDFYAPW
CGHCKRLSPELDAAAPVLSQLKQPIVIAKVNADKYTRLASKFDIDGYPTLKIFMHGVPVD
YYGPRKADLLVRYLKKFVAPDVAVLDSDVAITDFVQEAGMSFPIFIGFGVNETMVSNLGL
KYKKKAWFSVANDFSEGVMVQYDFDKVPALVAVHPSYNEQSIFYGPFEEKFLEDFIKQNF
LPPAVPMNHDTLKILKDDERKIVLTIMEDESDEKSQKLIKLLKAAASANRDLVFGYVGVK
QWEGFADTFGGNKKTKLPKMVVWNGDEEYLLVIGLESLEDEDQGSQISLFLEGYRKGQTI
QKQLSGPSFMGYINSLIGIRTVYIIVFMVAMLMLIQTIGKEEPLRVGTRDQVEDVSSSEP
ESSTAYGPGDKQD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagtttagttgtgacaatctcaatcttgtcactgttaatatcagtatcacagtca
tcagaagaatcaaatgagaaattcaaggtagatggcaaagtattggaactcgatgaatct
aacttcgatttagccatttcttctttcgatttcatcttcgttgacttctacgctccatgg
tgcggtcactgcaagcgtctctctcctgagttggatgctgctgcccctgttcttagtcaa
ttgaaacaacctatagtcatagcaaaagtaaatgctgacaaatatacgcgtctcgcttcc
aaatttgatattgatggatatcctactctcaagatttttatgcatggtgttcctgtcgac
tactatggaccacgaaaagctgatttacttgttcgttatttgaagaaatttgttgctcct
gatgttgcagtgcttgattctgacgttgctataactgactttgttcaagaagctggcatg
agcttcccaatttttataggttttggtgtaaatgagacaatggtttcaaatttaggtttg
aagtataagaaaaaggcatggttttctgtggctaatgatttttctgagggtgtcatggta
cagtatgattttgataaggttcctgctttggtagctgttcatcctagttataatgagcaa
agcatcttttatggaccctttgaagagaaattcttggaggacttcataaaacaaaatttt
cttcctccggctgtgcccatgaaccacgatacactgaagatattgaaagatgatgagaga
aaaattgtgttgaccatcatggaggatgaatctgatgaaaaatcacaaaaattgattaag
ttactgaaagctgctgcatctgcaaatcgtgacttagtattcggttatgttggtgtcaaa
caatgggaaggctttgctgatacatttggtggcaataagaaaacaaaactgccaaaaatg
gttgtttggaatggagatgaggagtatctcttggttattggtttagaaagccttgaagat
gaggaccagggatctcaaatctcactatttcttgagggttacagaaaaggccaaacaatt
cagaaacaactcagcggtccatcttttatgggatatatcaattcactaattggcatcaga
actgtgtacataattgtgtttatggttgcaatgctaatgctcatccaaacaattggcaaa
gaggaacctctaagggttggtactagagaccaagtcgaggatgtctcgagttctgaacct
gaaagcagcaccgcgtatggacctggagataagcaagattag

DBGET integrated database retrieval system