KEGG   Ricinus communis (castor bean): RCOM_0280030Help
Entry
RCOM_0280030      CDS       T01087                                 

Definition
diphosphonucleoside phosphohydrolase, putative (EC:3.1.3.57)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RCOM_0280030
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RCOM_0280030
Transfer RNA biogenesis [BR:rcu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RCOM_0280030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MENENKHKKYAKELDVAVRVVHMACTLCQRVQESLVSRSNDQVLSKDDDSPVTVADWSVQ
ATVSWILSETFRDQNVSIIAEEDVQTLSKDDSAGLLAAVANTVNEILAEASKYGLQSPTE
ALGGAQILEAISRCNSTGGPIGRHWVLDPVDGTLGFVRGDQYAIALALIENGKVVIGVLG
CPNYPMRKELLNHFHQCYQSISKSPLPTSDTGQKGCVIYAQRGSGEAWMQPLIHGNNKFQ
WPNSANRIKVSSIDDPELATFCEPVEKSNSNHIFSAGVAHSMGLKKQPLRVHSMVKYAAI
ARGDAEIFMKFASCGYKEKIWDHAAGVVIVEEAGGVVTDAGGRPLNFSRGIYLEGLDRGI
IACSGASLHEKLIGAVYASWDSSNL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgagaataagcataagaaatacgctaaggaattggatgtagcggttagagtt
gtacatatggcttgtacgctttgtcagagagtgcaagaaagcctggtttctaggagtaat
gatcaggttctgtctaaagatgacgattctcctgttactgttgcagattggagtgttcaa
gcaactgttagctggatattgtcagaaacttttagggatcaaaatgtatctatcattgct
gaagaagatgtccaaactctttccaaagatgactcggcaggtttactggcggctgttgca
aacacggtgaatgaaatattagctgaagcatcaaaatatggtcttcagagtcccacggag
gcccttggaggtgcacaaattcttgaggccatcagtcgatgcaactcaactgggggcccc
attggacgacattgggtacttgatcctgttgatggaacattaggatttgtgcgtggagat
caatatgctatagccttggccttgattgagaatggaaaagtggtgattggggtccttggg
tgtccaaattatcctatgaggaaagaattactgaatcattttcatcagtgctatcagagc
atatcaaaatcgcctttgcctacttctgatacagggcagaaaggatgtgtgatctatgca
cagagaggcagtggtgaggcatggatgcagccattaatccatggaaataacaaatttcaa
tggccaaattctgcaaaccggataaaggtctcttccattgatgatccagaactggcaact
ttctgtgaacccgtggaaaaatccaattcgaaccacatcttctcagctggggttgctcac
agcatggggctaaaaaaacaaccactgcgtgtccatagcatggtcaaatatgcagcgatt
gctcgaggagatgctgagatttttatgaaatttgcctcttgtgggtacaaagagaagata
tgggatcatgctgctggtgttgtcatagtagaagaggctggtggtgtggtgaccgatgct
ggtggaaggcccctaaacttctcgagagggatatacttggaaggtcttgatcggggcatt
attgcttgctctggtgcttcactacatgagaagctcattggggctgtttatgctagctgg
gactcttctaatctatga

DBGET integrated database retrieval system