KEGG   Ricinus communis (castor bean): RCOM_0292280Help
Entry
RCOM_0292280      CDS       T01087                                 

Definition
dfg10 protein, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     RCOM_0292280
    1.3.1.94  polyprenol reductase
     RCOM_0292280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MEIHLDWLLRLAWIAGTLPILLASLPSSSLNSFHQLLLGFAKRGKIMQLSSSSSSFHKFT
VPQRFFLHFYLLGVVWTTFLLIVTWHYAYKMTLLGSGSLIYSVASAHMAGGSRMLPFYKS
GFSNTELNYRVWLSVFMLLLMEMHVLRRLYETVYVLKYSPSARMHVFGYLTGLFFYTAAP
LSLCHFCIFEALNVAEYRAIEMNVKNEEISPIDFDWWGYMTPILQLGWCQWAGAAIFACG
WVHQQRCHAILGSLRKQRRQVDEYLIPHGDWFEMVSSPHYLAEMIIYLGLLVASGGNDLT
IWLLNLFVVANLAFAAAETQRWYLQKFEDYPRNRRAILPFVY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagattcatctcgattggcttcttcgattagcgtggattgctggaactttacccata
ttacttgcttcactcccttcttcttctttgaactctttccatcaacttcttctaggattt
gctaagagaggcaagattatgcaactatcatcatcatcatcatcattccataagttcaca
gttccacagagattcttccttcacttttacttgttgggtgtggtgtggactacctttttg
ctgatcgtaacttggcattatgcttataagatgactttattgggttctggctcattaatt
tactcggttgcttctgctcacatggctggaggttcacgaatgcttcccttttataagtct
ggtttttccaataccgagcttaattacagagtttggctgtctgtgttcatgcttctgttg
atggagatgcatgttttaaggcgcctttatgagacagtttatgtccttaagtacagtcct
tctgctcgaatgcacgtttttggttatctaacaggacttttcttctatacagcagcgcct
ttatcactttgccacttctgtatatttgaggctcttaacgttgcagaatatcgagcaatt
gagatgaatgtaaaaaacgaagagatttcacctattgactttgattggtggggatatatg
acgcctatcttacagcttggttggtgtcaatgggctggtgctgctatatttgcttgcggg
tgggtgcatcagcaacgatgtcatgcaatcttgggctctctgcgaaaacaaagaagacaa
gtagatgaatatctaattcctcacggtgattggtttgaaatggtttcaagtccacactac
ttggctgagatgataatatatttaggtttgttggttgcaagtggaggcaacgacctcacg
atatggctacttaatctatttgtggtagctaatcttgcctttgcagcagcagagacacaa
aggtggtacctacaaaagtttgaggactatccgcgtaaccggcgtgccattcttccattt
gtttattag

DBGET integrated database retrieval system