KEGG   Ricinus communis (castor bean): RCOM_0311630Help
Entry
RCOM_0311630      CDS       T01087                                 

Definition
beta-galactosidase, putative (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RCOM_0311630
  Lipid metabolism
   00600 Sphingolipid metabolism
    RCOM_0311630
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    RCOM_0311630
   00604 Glycosphingolipid biosynthesis - ganglio series
    RCOM_0311630
   00511 Other glycan degradation
    RCOM_0311630
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RCOM_0311630
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCOM_0311630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MVTKKRSHPKTTLFLAVIICLLALAVLVPVVFAPLPSLSHSHSHRHRKVNARRSFEINDD
MFWRDGKPFRIIGGDLHYFRILPQYWEDRLLRAKALGLNTVQTYVPWNLHEPQPGRLVFE
GIADLVSFLQLCQKLDLLVMLRPGPYICAGSRYTTDGGSRETLEKGTIRGDTVFSAVDFA
TGDDPWPIFNLQKKFNAPGKSPPLSAEFYTGWLTHWGEKIAQTDAEFTASSLEKILSRNG
SAVLYMAHGGTNFGFYNGANTGADESDYKPDLTSYDYDAPISESGDVDNAKFNALRRVIG
VHSAASLPSVPPNNDKTGYGPIQLHKTTFLFDLLDTINPADVVESKNPVSMESAGQMFGF
LVYVTRYAPKVDGSTLYIPEVHDRGQVFTLCPSDGSSGRPVYAGAIERWSNQKVLLPNSK
CASNISLFVLVENMGRVNYGRYMFDRKGILSSVYLDGRILNGWRMISLPLHNLNEVPKIN
PIIQAVHSTLSTRTKLEDYPRSFSIEPAFYTGYFFIEKEDQVKDTFISFSGWGKGIAFVN
DFNLGRYWPSFGPQCNLYVPSPVLRHGKNVLVILELESPHSELVIHSVSQPDFKCGSSRL
NVHQL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgaaaaagagatcacatcctaaaacgacgctgttcttagcagtcataatttgc
ttgctagctttagcagtgttggttccagtggtcttcgctcctctcccttctctatctcac
tctcactctcatcgtcacagaaaggtaaatgccagaagaagctttgagattaatgatgat
atgttttggagagatggtaagccatttaggataatcggtggtgacttgcactattttcga
attcttcctcagtactgggaagataggttattgagagcaaaggctctgggcttgaataca
gttcaaacttatgttccttggaatctacatgaaccgcaacctggcaggttggtttttgaa
ggtattgccgacctagtttcatttctccaactctgtcagaagctggatttgcttgttatg
cttcgacctggcccttatatatgtgcaggttctagatataccacagatggaggttctagg
gaaactcttgagaaaggaacaattcgtggagatactgtcttttcagctgttgatttcgct
accggtgatgatccttggcctatattcaatttacaaaagaagttcaatgccccagggaaa
tcaccaccactttccgcggagttctatactggttggctgacacactggggagagaagatt
gcacagacagatgctgaatttacagcatcttccttggaaaagattttatcacgaaatggt
tctgctgtgctttatatggcacatggtggaacaaactttggattttacaatggggcaaat
actggtgcagacgagtctgattacaagccagatctcacttcctatgattatgatgcacca
attagcgaatctggtgatgtggataatgcaaaatttaatgcactgcggagggttataggg
gttcatagtgcagcatctcttccctcagttccgcccaataatgacaagacaggatatgga
cctattcaactacataaaacaacatttttgtttgatttacttgatacgataaatcctgct
gatgtggttgaatccaaaaacccagtctcaatggaatctgcgggacagatgtttggattt
ctagtatatgttactcgatatgctccaaaggttgatgggagtactctatatataccagag
gtgcatgatagaggtcaggtgtttacattgtgcccttctgatggtagcagtggaaggcca
gtgtatgctggtgcaattgaaaggtggtcgaatcaaaaagttctccttcctaattccaaa
tgtgcttccaacatcagcttatttgttttggtcgagaacatgggccgtgtaaattatggg
cggtacatgtttgataggaagggaattttgtcatctgtttatctggacggtagaattttg
aatgggtggagaatgatttcacttcctcttcacaatctgaacgaggtgccaaaaatcaat
cccatcattcaagctgtacattcaacattatcaactcgcacaaaattagaagattaccca
aggagtttttccatagaaccagcattctatacagggtatttttttattgagaaagaagac
caagttaaagatacattcatatcattcagcggttggggtaaagggatagcttttgtaaat
gattttaacttaggaagatattggccgtcgtttggaccacaatgcaacctttatgtccct
tctccagtcctcaggcatgggaaaaatgttctggttattctggagttagaatctcctcat
tcagagcttgtgatacattcagtgagccagccagacttcaagtgtggttcaagtagattg
aatgtgcatcagctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system