KEGG   Ricinus communis (castor bean): RCOM_0339630Help
Entry
RCOM_0339630      CDS       T01087                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RCOM_0339630
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    RCOM_0339630
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     RCOM_0339630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 601 aa AA seqDB search
MGSYRKERKFKKLPEPPSKYELGSYNYKMFNLFNRKFKITEAEPPNDVKEVFAKFSYGER
HMSPDQFRRFLVLHQDLVDCTLADAQRIVEDVINKRHHITKYTRYGLNLDDFFHFLLFDD
INGPIIPQVHHDMTAPLSHYFIYTGHNSYLTGNQLSSDCSEVPIVKALQRGVRVIELDLW
PGSTKDEVLVLHGRTLTTPVPLIKCLKSIRDYAFVSSPYPVIITLEDHLMAEQQAKVAEM
LTQIFGDTLYYPESDGLVQFLSPESLKHRIMISTKPPKEYLESSGISSIKMKETRSPHGR
NSSEEEEEAEAEADHRSDSDQDDEDCDNKSGNLASPEYKRLITIHAGKPKGALKDAIKVA
ANKVRRLSLSEQELEKAATTHGMDLVRFTQENILRVYPKGTRITSSNYEPIIGWMHGAQM
IAFNMQGYGKSLWLMHGMFRGNGGCGYLKKPDFLMQKDEELFDPKRTLSVIKTLKVKVYL
GDGWRLDFSHTHFDSYSPPDFYTKLYIVGVPADDAKRKTKIIEDNWAPAWNEEFAFPLTV
PELALLRVEVREYDMSEKDDFGGQTCLPVSELRPGIRSVPLHDKKGEKLNNARLLMKFEF
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggaagctacaggaaagaacgtaaattcaagaaattaccagagccaccgtcaaaatat
gaactgggtagttacaattacaaaatgttcaatcttttcaatagaaaattcaagattaca
gaagctgagccacctaatgatgttaaagaagtttttgcaaagttttcttatggtgaacgt
catatgagtcccgatcagtttcgcaggttcttggttttacatcaggatttggtggactgt
accttagctgacgctcaaaggattgttgaagatgttattaataaaagacatcatataact
aagtacactagatatggtcttaatcttgatgattttttccatttcttgctttttgatgat
atcaatggtcctatcattcctcaggtacaccatgatatgactgctccattgtcacattat
ttcatatatacaggacataattcctatctgactgggaatcagttgagcagtgattgtagc
gaggtccctattgtaaaggctctgcaaagaggtgtgagagtaattgaactagatttgtgg
ccaggttctacaaaagatgaggttcttgttcttcacgggaggaccctgacaactccagtg
ccacttatcaaatgtctgaagtccataagagactatgcttttgtcagttctccataccct
gtcattattactttagaagaccacctcatggcagagcaacaagcaaaagttgcagagatg
cttacacaaatatttggagacacgctgtattatcctgagtcagatggcttagtccaattc
ctttcaccagaatctttaaaacatcggataatgatttcaaccaaaccaccaaaagaatac
cttgaatctagcggtatcagtagtatcaagatgaaggaaactcgctcaccacacggcagg
aattcatctgaagaagaagaagaagctgaggcagaagctgaccataggagtgatagtgat
caagatgatgaagactgtgacaataaatcaggaaaccttgcatcccctgaatacaaacgt
ctaattacaatccacgctgggaagccaaagggtgccttaaaggatgcaatcaaagttgca
gctaataaagttagacgactaagtttgagcgaacaggagcttgagaaggctgccacaact
catggaatggatttagtgagatttacacaggagaatattctgagagtatatcctaaagga
acacggatcacctcctccaattacgagcctataattgggtggatgcatggagcacagatg
attgcatttaacatgcagggatacggcaaatcactttggttgatgcatgggatgtttagg
gggaatggagggtgtggttacctgaaaaagcctgattttctaatgcagaaagacgaggag
ttgtttgatcctaaaagaacattatcagtgattaagacattaaaggtaaaagtatatttg
ggtgatggatggcggttggattttagccacacacactttgattcctactcaccaccagac
ttctacacaaagctttacattgttggggtaccagctgatgatgccaagagaaaaacgaaa
ataatcgaggacaactgggctcctgcttggaacgaggagttcgcattccccttgacagtt
cccgagctagctttgctgagggttgaagtacgagaatatgacatgtccgaaaaggatgac
ttcggtgggcagacatgtttgcctgtctcagaactaagaccagggattcgatcagtaccc
cttcatgataagaaaggagaaaagctgaacaatgcaaggcttctaatgaagtttgagttt
gtataa

DBGET integrated database retrieval system