KEGG   Ricinus communis (castor bean): RCOM_0411680Help
Entry
RCOM_0411680      CDS       T01087                                 

Definition
serine-threonine protein kinase, plant-type, putative
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 620 aa AA seqDB search
MEISLFFLSSFQVLLLFLLFISTTYVTAQSPQGTNFSCSVDLPSPCQTYVAYYAQPPNFL
NLGNISDLFAVSRLSIASASNLVSEDIPLMPNQLLLVPITCGCTGNSSFANITYQIKPGD
SFYFVSTTYFENLAKWQAVESFNPNLDPTLLHPGDKVVFPLFCKCPSKNQMKHGIQYLIT
YVWQPEDDIFKVGAKFNASPHDIAIQNNYWDFSTAVHHPLLIPVTQMPILSQPSPSWPQR
SEHHLVIIIVTSVAGALLIFLLVAFLVHAHCSCKKKKKTMTLHRNGSCLETTDLLQIKEQ
GKYRSFEPKIIQDKLLPGVSGYLGKPIMYDIKEILLATMDLHEHYRIGGSVYRANINGQV
LAVKKTKVDITEELNILQKVNHANLVKLMGISSNADGDCFLVYEYAENGSLDKWLHPKPA
SSSSSVAFLSWSQRLQIALDVASGLQYMHEHIQPTVVHMDIRTSNILLDSRFKAKIANFS
VAKLTTDSMLQKVDVFAFGVVLLELLCGKKAMVTNENGEIVLLWKEMKGVMEVAEKRAER
LKKRMDPNLENFYPIDSALSLANLARVCTLEKSSARPSMAEIVFNLTVLTQSCSETLERS
WTSGLEAEEDIQITSPVIAR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttctcttttctttctctcttccttccaagtacttcttctctttcttctgttc
atttccaccacatatgtcactgcacaatcaccacaaggcacaaacttttcttgctctgtg
gatttaccttccccttgccaaacttatgttgcatattatgcccagccaccaaactttctg
aatctgggaaacatttctgatctatttgcagtcagtcgtctgtcaattgcgagtgctagc
aacctagtgtctgaggacattccattaatgccaaaccagcttttacttgtacctataact
tgtggctgcacagggaacagttcttttgccaacatcacttaccagatcaagcctggtgat
agcttctattttgtttcaaccacttacttcgagaatcttgccaagtggcaagcagtggaa
tctttcaaccccaatctagatccaaccctcttacatcctggtgacaaagtggtttttcct
ttgttctgtaagtgtccctccaagaatcaaatgaaacatggtattcaatatcttattact
tatgtgtggcaacctgaggatgatattttcaaagtgggtgctaagtttaatgcatctcca
catgatattgcaatccagaataactactgggacttcagtactgcagtgcaccacccgctg
ctgatccctgtaactcagatgccgattctctctcaaccatctccctcttggcctcagaga
agtgaacatcatttggtcatcataatagttacaagcgtagcaggtgcccttttgatcttc
cttcttgtggcttttcttgttcatgctcattgttcatgtaagaagaagaagaagacaatg
actttgcatcgtaatggttcctgtttggagactacagatcttcttcaaataaaagaacaa
gggaagtatagaagttttgagcctaagattatacaagataagctacttcctggggtttca
ggctatttaggcaagccaatcatgtatgacattaaagagattttgttggcaaccatggac
ctacatgaacactacaggataggaggatcagtatatagagctaacatcaatggacaggtc
ttagcggtaaagaaaaccaaggtagatatcacagaggaattaaatattctgcagaaggtg
aatcatgcaaatctagtgaaactaatgggaatttcatccaatgcagatggtgattgcttc
ttggtctatgaatatgcagaaaatgggtctctggataagtggttgcaccccaagcctgca
tcttcttcaagctctgtagccttcttatcctggagtcaaaggttacaaatagcactagat
gtggccagtgggctgcaatacatgcatgaacatattcaaccaaccgttgttcacatggat
atacgaacaagtaatatacttcttgactctaggtttaaagcaaagatagcaaatttctct
gtcgctaaactcaccacagactctatgctgcaaaaagttgatgtttttgcttttggtgtt
gttctgttagagttgctctgtgggaaaaaagccatggtaacgaacgaaaatggtgagatt
gttttgttgtggaaggaaatgaaaggtgtcatggaagttgcagagaaaagggcagagagg
ttaaagaaacggatggatccaaacttggagaacttctatccaatcgatagtgccctgagt
ttggcaaacttggcaagggtgtgcacgctggagaagtcttcagccaggccgagcatggca
gaaattgttttcaaccttacagttctaacccagtcatgttcggagacattagaaaggtcg
tggacttctggcctagaagcggaagaagatattcagataactagtcctgtcatagctcgt
tga

DBGET integrated database retrieval system