KEGG   Ricinus communis (castor bean): RCOM_0471040Help
Entry
RCOM_0471040      CDS       T01087                                 

Definition
plant poly(A)+ RNA export protein, putative
Orthology
K14298  
mRNA export factor
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    RCOM_0471040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 349 aa AA seqDB search
MATFGAAATANQNPNKSIEVSQPPSDSVSSLCFSPKANFLVATSWDNQVRCWEITRNGTT
IGSVPKTQITHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEI
AWIPEMNLLATGSWDKTLKYWDTRQSNPVHTQQLPDRCYAMTVRYPLMVVGTADRNLIVF
NLQQPQTEYKRITSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHLDDAQQNKNFTFKCH
RDGNDIYSVNALNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMSRCPLPIPCCTFNNDG
SIFAYSVCYDWSKGAENHNPQTAKTYIYLHLPQESEVKGKPRVGTSGRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctacttttggtgctgccgcgactgctaatcaaaaccctaacaaatctattgaggtg
tctcaacctcctagtgactcggtttcgagtctctgtttcagtcccaaggccaatttcttg
gttgctacttcctgggataaccaggtaagatgctgggaaatcacaaggaatggaaccact
ataggaagtgttcccaagacacaaataacacatgaccaaccggttttatgctctgcttgg
aaggatgatggtacgactgtcttttctggaggctgtgacaagcaagtgaagatgtggcct
ttactctctggaggtcaacctgtaactgttgcaatgcatgatgcaccaattaaagagatt
gcatggattccagagatgaacttgctggccacaggaagttgggataagaccttgaagtac
tgggatacaagacagtcaaatccagtgcacactcaacagcttcctgatcgttgttatgca
atgacagtgcgttatcctttgatggttgttggcactgcagatagaaatctcatagtcttc
aaccttcaacaacctcagactgagtacaagagaatcacttctcccttgaagtatcaaaca
agatgtgttgctgcttttcctgatcaacaaggcttcttggttggctcaatcgaggggagg
gttggtgtacatcatctagatgatgcgcaacaaaataagaacttcacttttaaatgccat
agagatggcaatgacatatactcggtcaatgccttgaacttccatccggtgcatcacaca
tttgcaactgcaggatctgatggtgcttttaatttttgggacaaggatagcaaacagagg
ttaaaggccatgtcacgctgtcctcttcccataccctgctgtactttcaacaacgatggc
tcaatttttgcatattcggtgtgctatgactggagcaagggtgcagagaaccacaaccca
caaactgcaaagacctacatctatctgcatttgccacaggagtcagaggttaaaggcaaa
ccacgagttggaacgagcgggagaaagtaa

DBGET integrated database retrieval system