KEGG   Ricinus communis (castor bean): RCOM_0475410Help
Entry
RCOM_0475410      CDS       T01087                                 

Definition
histone h2b, putative
Orthology
K11252  
histone H2B
Organism
rcu  Ricinus communis (castor bean)
Brite
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RCOM_0475410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MAPKQEKKPAEKKPVAEKAPAEKKPRAEKKLPKEGPGAGADKKKKRAKKSIETYKIYIFK
VLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPTITSREIQTAVRLVLP
GELAKHAVSEGTKAVTKFTSS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaacaagagaaaaagccagcagagaagaaaccggtggcggagaaagctccg
gccgagaagaagccaagagcggaaaagaagctgccgaaagaaggccctggcgccggcgca
gacaagaaaaagaagcgtgcaaagaagagcattgagacttacaagatttacatattcaag
gtgttgaagcaagtgcaccctgatattgggatatcaagcaaagcaatgggaatcatgaac
agttttataaatgatatatttgagaaactggcgcaagaagcagcaagacttgctaggtat
aacaagaaacccactattacttcaagggagattcaaactgctgttagattggtgttgcct
ggtgaacttgctaagcatgctgtctctgagggtactaaagcagttactaagtttactagt
tcctag

DBGET integrated database retrieval system