KEGG   Ricinus communis (castor bean): RCOM_0479760Help
Entry
RCOM_0479760      CDS       T01087                                 

Definition
asparagine synthetase, putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RCOM_0479760
Enzymes [BR:rcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RCOM_0479760
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C44
   RCOM_0479760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 591 aa AA seqDB search
MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDSYLAHQRLAIIDPASGD
QPLYNEDKAIVVTVNGEIYNHEELRKKLSHHKFRTGSDCDVIAHLYEEYGEDFVDMLDGM
FSFVLLDTRDNSFIVARDAIGITSLYIGWGLDGSIWISSELKGLNDDCEHFECFPPGHLY
SSKSGGLRRWYNPPWFSEAIPSTPYDPLALRRAFENAVIKRLMTDVPFGVLLSGGLDSSL
VASITARHLADTKAAKQWGAQLHSFCVGLEGSPDLKAAKEVADYLGTVHHEFHFTVQDGI
DAIEDVIYHIETYDVTTIRASTPMFLMARKIKALGVKMVISGEGSDEIFGGYLYFHKAPN
KEEFHRETCHKIKALHQYDCLRANKATSAWGLEARIPFLDKEFINVAMAIGPESKMIKPE
EGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVGYSWIDGLKAHAAEHVTDKMIQN
AEHIFTHNTPTTKEAYYYRMIFERFFPQNSARLTVPGGASIACSTAKAVEWDAAWSDNLD
PSGRAALGVHLSAYGKQAAAAVASAGMVPPKIIDSMPRMMEVSPPGLTISS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatacttgctgttctgggttgctctgatgattcccaagccaaaagggttcga
gttcttgagctctctcgcagattgaagcaccgtggcccagactggagtggtctatatcag
cacggagactcttacttggcacatcaacgtcttgctatcatagatcccgcctctggtgat
cagcccctttataatgaagacaaagccattgttgtcactgtgaatggggagatttacaat
catgaagagctgaggaagaaattgagccatcacaagttccggacgggaagtgattgtgat
gtgattgcccatctgtacgaggaatatggtgaagattttgtagacatgttggatggaatg
ttttcttttgtgcttcttgatacacgagacaatagtttcattgttgctcgtgatgccatt
ggaatcacctccctctatattggctggggccttgatggttctatttggatatcgtctgaa
ctgaaggggctgaatgatgattgtgaacattttgagtgctttccacctggtcatttgtac
tcgagcaagtcaggtggattaaggcgatggtataatcccccatggttctcggaagcaatt
ccatcaactccgtatgacccacttgctctaagacgagcatttgaaaatgctgtgattaaa
aggcttatgaccgatgtgccttttggagttctgttatccgggggcttggattcatcattg
gttgcctctatcactgctcgccacttggccgacacaaaagctgccaagcaatggggagct
cagctccattctttctgtgttggcctagagggttcacctgatttgaaggctgcaaaagaa
gtagcagattatttgggtactgttcaccatgaatttcacttcactgttcaggatggtatt
gatgctattgaagatgtcatttaccatattgaaacatatgatgttacaactatcagagca
agcactcctatgttccttatggcaaggaagatcaaggcacttggagtcaagatggtcatt
tctggtgaaggctctgatgagatctttggtgggtatctgtactttcataaggcacctaat
aaggaagagtttcaccgtgaaacatgtcacaagataaaggctcttcatcagtatgactgc
ttaagagctaacaaggcaacatcagcatggggtttggaagctcgaatccctttcttagat
aaggaatttattaatgttgctatggctattggtcctgagtcgaaaatgattaagccagag
gaaggacgcattgaaaaatgggttcttagaagagcttttgatgatgaggagcatccttat
ctgccgaagcatatcttgtacagacagaaagagcaatttagtgatggtgttggctatagc
tggattgatggcctcaaagctcatgctgcagaacatgtgactgataagatgatacaaaat
gctgagcacatcttcactcataatacccctactaccaaggaagcatattactacagaatg
atttttgaaaggttcttcccacagaactcagccaggctgactgttcccgggggagcaagt
atagcatgcagcactgccaaagctgttgaatgggatgctgcatggtcagataatcttgat
ccttctggcagggctgcattaggcgtccatctttcagcttatggaaaacaggcagcagct
gctgttgcaagtgcaggaatggtgccgccaaagatcattgatagtatgccaaggatgatg
gaggttagccctcctggtctcacaatctcaagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system