KEGG   Ricinus communis (castor bean): RCOM_0507720Help
Entry
RCOM_0507720      CDS       T01087                                 

Definition
beta-hexosaminidase, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RCOM_0507720
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    RCOM_0507720
   00603 Glycosphingolipid biosynthesis - globo series
    RCOM_0507720
   00604 Glycosphingolipid biosynthesis - ganglio series
    RCOM_0507720
   00511 Other glycan degradation
    RCOM_0507720
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RCOM_0507720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 571 aa AA seqDB search
MRITTFIITCCTLLTATATGITVWPKPRVFTWQHPQFATLVSPAFAITAPNHPHLSPAIN
RYLHQILTERYPPLINPSINISNASPPLQILSITVSNLATPLHHGVNESYSLIIPAKDST
ATIIADTVWGAMRGLETFSQLVWGNPSRVPVGVYVWDAPLFGHRGLMLDTSRNYYPVSDI
MRTISAMSANKLNIFHWHITDSHSFPMVFPSEPGLAEKGSYGNNMRYTPEDVADVVKFGL
EHGVRVLAEIDSPAHTGSWAGAYPDLVTCANMFWWPAGSEWPDRLASEPGTGQLNPLNPK
TYEVLKNIIADAVTMFPEPFYHAGGDEIIPGCWKADPAIQSFLSDNGTLSQLLETFVRST
FPYIVSLNRTVVYWEDILLDDNVKVDAAILPPEHTILQTWNNGPNNTKLIVDAGYRAIVS
SSEFYYLDCGHGDFLGNDSQYDQPPTANDTGNGGSWCGSFKTWQTIYNYDITYGLSEKEA
ELVLGGEVALWSEQADPAVLDVRLWPRTSAMAETLWSGNRDETGMKRYAEAMDRLNEWRY
RMVSRGIRAEPLQPLWCIRNPGMCNTVHPLV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcactaccttcatcattacctgctgcaccctactgacagccacagcaacaggc
atcactgtgtggccaaagccaagagttttcacatggcagcatccacagttcgccacactt
gtctctccagccttcgcaataaccgcacctaaccacccacatctctctcccgccataaac
cgttaccttcaccaaatcctcaccgagcgttacccgcctctcataaacccttccatcaac
atctccaacgcatccccaccgttgcaaattctctctattacagtctccaacctcgccact
ccacttcaccacggtgtcaatgagtcctactcgcttatcatccccgcgaaggactccact
gccactataattgctgacacagtgtggggtgcaatgcgaggactcgaaacgttctcacag
cttgtatggggtaacccttcacgtgtccctgttggggtttatgtgtgggatgctcctctt
tttggacatagaggtctaatgttggatacttcgaggaattactatccggtttcggatata
atgaggactattagtgctatgagtgctaataaacttaatattttccattggcatattact
gattcgcattcgtttcctatggtgttcccttctgagcctggacttgctgagaagggttct
tatgggaataatatgcggtacactcctgaggatgttgctgatgttgtcaagtttggtttg
gaacatggagtcagggttttagctgaaattgactctcctgctcatacaggatcatgggct
ggagcttacccagatcttgtgacatgtgcaaatatgttttggtggccagctgggagtgaa
tggcctgacaggcttgcatctgaaccaggaactggccaactaaacccactgaatcctaag
acctatgaagtgctcaaaaacataattgctgatgcagtcaccatgttccctgaaccattt
taccatgctggaggtgatgagatcatcccaggatgttggaaagctgacccagccattcaa
tccttcctatcagataatggaaccctcagtcagctgttggagacctttgtccgttccacc
ttcccttatattgtatcactcaatcgtacagttgtgtactgggaagatattttgttggat
gacaatgtcaaggtggatgctgcaattcttccgcctgagcataccattctacaaacatgg
aataatggtccaaacaatacaaaactgattgttgatgctggctatcgagctattgtttca
tcctcggaattctattatttggattgcgggcatggtgactttcttgggaatgatagccaa
tatgatcagccaccaacagctaatgatacaggaaatggcgggtcctggtgtggatccttc
aaaacatggcaaaccatatataactatgacataacatatgggctaagtgagaaggaagct
gaattggtactagggggtgaggtggcattatggtcagagcaagctgacccagcagttttg
gatgtacgtctttggccgagaacttcagcaatggctgagactttgtggtcagggaatagg
gatgagacaggtatgaagaggtatgctgaagcaatggatcgtttaaatgagtggaggtac
agaatggtcagcagaggaatcagagctgaacctcttcaaccactctggtgcattaggaac
ccgggcatgtgcaatacagttcatccattggtttaa

DBGET integrated database retrieval system