KEGG   Ricinus communis (castor bean): RCOM_0521870Help
Entry
RCOM_0521870      CDS       T01087                                 

Definition
chromatin regulatory protein sir2, putative
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     RCOM_0521870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 466 aa AA seqDB search
MSLGYAEKLSFIEDVGNVGMAEFFDSSYVLQEKIERLAKMIQKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKPLPEASLPFHRAMPSITHMALVELERAGIVKFIISQNVDGLH
LRSGIPREKLAELHGNSFMESCPSCGAEYFRDFEVETIGLKETSRRCSDVKCGAKLRDTV
LDWEDALPPKEMLPAEKHCRMGDLVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTP
KDKKASLVIHGFVDKVIAGVMHLLSMQIPPYVRIDLLQIIVTRSLSADKRFVNWTLRIAS
VHALKATLPFIKSIEVTFSDTQKYKAAILHEQPFNLKRRTVTTESFEIFLKLNLSDGCGC
LCTQINIPFGFKVLNDCFNLKKDSVIQNLREKAIQVLGCGQNAMIERKTIIAPRSEVTVH
AIVTNIKAFESDGLSNGEVKRLRGSSINGIMTCRKRSNSRKRKSRF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggctatgctgagaagctttccttcattgaagatgtgggtaatgttggaatg
gcagaattttttgattcatcctacgttttgcaggaaaaaattgaacgacttgccaagatg
atacaaaagagtaagcatctagtagtgtttacaggggctggaatatcaacttcttgtggc
atacctgattttcgaggccccaagggaatctggacgttgcagcgtgagggcaaaccttta
cctgaagcatctctgccatttcatcgagcaatgccaagtatcactcatatggctttggtt
gaacttgagagggctggtattgtaaagttcatcattagtcagaatgttgatggcctccat
cttcggtctggaattccaagagagaaacttgctgagttacatgggaactccttcatggaa
agttgcccttcatgtggagctgagtattttcgggattttgaggtggaaactattggattg
aaggagacatcacgccgctgctctgatgtgaaatgtggagcaaaactaagggatacagtt
cttgactgggaggatgcattgcccccaaaagagatgcttccagctgagaagcactgcagg
atgggtgatcttgtgttatgtttagggacaagtttgcaaataactcctgcatgcaacctg
cccctgaaatgtctccgaggtggaggaaagattgtaattgtgaatcttcagaaaactccg
aaggacaagaaagctagtttggtgatccatgggtttgtagataaggttattgcaggagtc
atgcatctccttagtatgcagattcctccatatgtcaggattgatcttcttcagatcatt
gtaactcggtccctgagtgcagataaaagatttgtgaattggaccctccggatagcaagc
gtacatgcactgaaagctacattgccattcataaaatccattgaggttaccttctcagat
acacagaagtataaagcagcaattctacatgagcaaccttttaacctgaaaaggagaact
gtgactacagaatcatttgaaattttcttgaaactcaacttaagcgatggctgtggttgt
ctatgcacccaaatcaatatcccttttggttttaaggttttgaatgactgttttaacctt
aaaaaggacagtgtaatacaaaatctgagagagaaggcaattcaagttctcggttgtggt
caaaatgccatgattgaaagaaagaccatcatagccccgagaagtgaggtcacagtccat
gccattgtaaccaacatcaaagcatttgaatcagatggtttgagcaatggcgaagtgaaa
aggctaagaggaagtagtataaatggtataatgacatgtcgaaagcgatcaaatagccgg
aaacgcaagtcaaggttttag

DBGET integrated database retrieval system