KEGG   Ricinus communis (castor bean): RCOM_0528130Help
Entry
RCOM_0528130      CDS       T01087                                 

Definition
amsh, putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    RCOM_0528130
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     RCOM_0528130
Peptidases [BR:rcu01002]
 Metallo Peptidases
  Family M67
   RCOM_0528130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MMNGDEAEPASLCSDSSPCLDTLEFSCQNLTQKEGKCPQITVHTVTQSSPSPILSCVEKA
PKHAHISPIPAAGSNTNPCNQPSSSNILQDIHISERLMEDFLELARENTEKDLETCGVLS
AFLEMGTYYVTTLIIPKQNSTSSSCEAIKEEEFFAIQNERSLHPVGWIHTHPSQSCFMSS
IDLHTQYSYQVMVPEAFAIVMAPTDTSRSYGLFRLSDPGGMGVLKECQETGFHPHGEPAD
GGPIYEHCSNVYANSNLRFEIFDLR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatggagatgaagctgagccagcatctttgtgttcggattctagcccttgcttg
gacacacttgaattttcctgccagaacctgactcagaaagagggcaaatgcccccaaatc
actgtccacacggttacgcaatcttccccttcccccatactctcatgtgtagagaaagca
cctaaacatgctcatatttcacctataccagcggccggctcaaacaccaatccatgcaat
caaccatcatcatctaacatcttgcaagacatacatatatcagaaaggttgatggaggat
tttcttgaacttgcaagggaaaatacagagaaggatcttgaaacctgtggggttctcagt
gctttccttgaaatggggacatattatgtgaccactctgataatacccaaacaaaactcg
acttccagttcttgtgaggctataaaagaggaagagttttttgccatacagaatgaacgg
tcacttcatcctgtgggatggattcatacacatccttctcaaagttgtttcatgtcatca
atagatctgcacactcaatactcatatcaggtaatggtaccagaagcttttgccattgtc
atggctccaaccgatacctcaaggagctatgggctgttccggctatccgacccaggtgga
atgggtgttctgaaagaatgtcaagaaactggattccatccccacggagagccagcagac
ggaggcccgatttatgagcactgctctaatgtatacgcaaattctaatctgaggtttgaa
atctttgatttgcgctga

DBGET integrated database retrieval system