KEGG   Ricinus communis (castor bean): RCOM_0535930Help
Entry
RCOM_0535930      CDS       T01087                                 

Definition
aldose 1-epimerase, putative
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0535930
Enzymes [BR:rcu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     RCOM_0535930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MAMVSIPFSSPPTLNLRRVNRLYRYSGMAFASVSKGTATVGVSVTEGEGSLPKIVLTSPH
GSEAEIYLFGGCITSWKVATGKDLLFVRPDAVFNKKKPISGGVPHCFPQFGPGTIQQHGF
ARNMDWSIADSENVEGNPVVTLMLKDGPYSRAMWDFGFQALYKVILDAKSISTELKITNT
DNKPFSFNTALHTYFSASVTGASVRGLKGCKTLNKDPDPNNPIEGKEERDVVTVPGFVDC
IYLDAPEELQLDNGLGDVITIKNTNWSDTVLWNPHLQMEACYKDFVCVENAKIGKVELEP
GQSWTAKQHISIG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggtatctatccctttttcttctccccctacccttaatcttcgccgagtcaac
cggctttacagatactccgggatggcatttgctagtgtaagtaaaggaactgcgactgtc
ggagtaagtgttactgaaggtgaaggtagtttaccaaagattgtgctgacttctcctcat
ggtagtgaggctgagatatacttgtttggaggttgcatcacatcttggaaagtcgccact
ggtaaagacctcctttttgtaaggcctgatgctgtatttaacaagaaaaagccaatcagc
ggaggcgttccacattgtttcccgcagtttggacctggaactattcagcagcatggattt
gcaaggaatatggattggtcaattgctgattctgaaaatgtagaaggcaatcctgttgta
actctgatgctcaaggatgggccttatagtcgtgccatgtgggactttggtttccaggct
ttatacaaggtcatccttgatgcaaagagcatttccacagaactaaagattacgaataca
gacaacaagccattttcatttaatacggcactacatacatatttcagcgcttctgtaact
ggggcatctgtgagaggtttaaaaggttgcaaaacactcaataaggatccagatcctaac
aatcctatagagggcaaagaggaaagggatgtggtcactgtccctggatttgtagactgc
atttaccttgatgctcctgaggaattgcaacttgataacggcttaggtgatgttataact
atcaagaacacaaactggtcagacactgtactgtggaatccacatcttcagatggaagct
tgttacaaagattttgtttgtgttgaaaatgccaagattggaaaggttgagctagagcct
gggcaatcctggacagctaagcagcatattagcattggctaa

DBGET integrated database retrieval system