KEGG   Ricinus communis (castor bean): RCOM_0538120Help
Entry
RCOM_0538120      CDS       T01087                                 

Definition
5-AMP-activated protein kinase, putative (EC:2.7.11.17)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    RCOM_0538120
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     RCOM_0538120
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   RCOM_0538120
Mitochondrial biogenesis [BR:rcu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    RCOM_0538120
  Mitophagy factors
   Other mitophagy factors
    RCOM_0538120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 468 aa AA seqDB search
MDGSSHRGGSSADVFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEM
EEKVRREIKILRLFMHPHIIRLYEVIETSTDIYVVMEYVKSGELFDYIVEKGRLQEDEAR
NFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSP
NYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHL
SPGARDLIPRMLVVDPMKRMTIPEIRLHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQE
VVKMGFDRNQLIESLRNRLQNDATVAYYLLLDNRFRVSNGYLGAEFQETMSRAHPREIMT
EVLKALQELNVCWKKIGHYNMKCRWIPGIPGHHEGMANDPVHNNHFFGDESTIIENDGVA
KTPNVVKFEVQLYKTREEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatgggtcaagtcaccgaggtgggagtagtgctgatgtgtttttgccaaattataaa
cttggtaaaactcttggaatcggttcttttggaaaggtgaaaattgcagagcatgcattg
acgggccacaaagttgccatcaagatactcaatcgtcgaaaaataaaaaacatggagatg
gaagaaaaagtgagaagagaaatcaaaatcttgaggttgtttatgcaccctcacattata
agactttatgaagttatagaaacatcaactgatatttatgttgtcatggagtatgtcaag
tctggggagctctttgactatattgtggagaagggtaggctacaagaagatgaggcgcgt
aattttttccagcagataatttccggtgtggaatactgccataggaatatggttgttcat
agagacctgaagcctgagaatttgcttttggattctaagtgcaatgtgaaaatagcagat
tttggcttgagtaatataatgcgagacggtcattttctaaagacaagttgtggaagtcca
aactatgctgcaccagaggtcatatctgggaaattgtacgcggggcctgaagtggatgta
tggagctgtggtgttatattgtatgctcttctctgtggtacccttccttttgacgatgaa
aacattcccaatctctttaagaaaatcaagggtgggatatatactcttcccagccattta
tcacctggtgcaagagatttgatcccaaggatgcttgtggttgatccaatgaagcgaatg
accatccctgaaatccgtctgcacccatggttccaagctcgccttccacgttatttggct
gtccctccaccagacaccatgcaacaagctaaaaagattgatgaagagattctccaggaa
gtggtcaagatgggatttgacaggaaccaacttattgaatctcttcgcaacagattacaa
aatgatgccactgttgcatactatttgttattggacaataggttccgcgtttccaatggc
tatcttggagctgagtttcaagaaacaatgtcacgagcccaccctcgtgaaataatgaca
gaagttctcaaagctctacaagaactgaatgtgtgttggaagaaaattggtcactacaat
atgaaatgcaggtggattcctggcattcctggtcatcatgaaggcatggctaatgaccct
gtgcacaacaatcatttctttggggatgaatccactattattgagaatgacggagttgcc
aagacaccaaatgtggtgaagtttgaagtgcagctttacaaaactcgcgaggagaaatac
ttgctcgacttacaaagggtacaggggccacagtttctcttcttggatctttgtgcagct
tttcttgcacaacttcgagtcctttag

DBGET integrated database retrieval system