KEGG   Ricinus communis (castor bean): RCOM_0575930Help
Entry
RCOM_0575930      CDS       T01087                                 

Definition
histone deacetylase 1, 2, 3, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     RCOM_0575930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MTHALLAHYGLLQHMQVLKPFPARDRDLCRFHADDYVAFLRSITPETQQDQLRQLKRFNV
GEDCPVFDGLYSFCQTYAGGSVGGAVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDI
VLAILELLKQHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGY
GKGKYYSLNVPLDDGIDDESYHFLFKPIIGKVMEVFKPGAVVLQCGADSLSGDRLGCFNL
SIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGMDVDDKMPQHEYYEY
FGPDYTLHVAPSNMENKNSHPLLDEIRSKLLDYLSKLQHAPSIQFQERPPNTDIPEADED
QDDGDERWDPDSDMDVDDERKPLPSRVKREILEAEPKDLESQKGIADHARGFETTADESA
SAKALDIGAMQIDEPSVKVEQDNMNKTTDQVFSKS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgctcttcttgcccattacggtttgcttcagcatatgcaggtccttaagcct
tttcctgctcgagatagggatctgtgccgcttccatgctgatgattatgttgctttcctc
cgtagcattacccctgaaacccagcaggaccaactccggcagctcaaacgctttaatgtt
ggtgaagattgccctgtctttgatggtctttactccttttgtcagacttacgccgggggt
tctgttggcggtgctgttaagttaaaccatggtctttgcgacattgctatcaattgggct
ggtggcctccatcatgctaagaagtgtgaagcttctggcttttgctatgtcaatgatatt
gtcctggctatcttggagcttcttaaacagcatgagcgagttctttatgttgatattgac
attcaccatggtgatggcgtagaagaggcgttttacactactgatagggtaatgacggtt
tcatttcataaatttggagattattttccaggtacaggggatatacgtgatattggatat
gggaaagggaaatactactcccttaatgttccattagatgatggaattgatgatgagagt
tatcatttcctatttaaaccaattattggaaaagtaatggaagtatttaagcccggtgct
gtggttcttcaatgcggtgctgactcattatccggggatagattaggatgcttcaatctg
tcaatcaagggtcacgcagagtgtgtcaaatttatgagatctttcaatgtgccattattg
ttattgggtggtggtggttataccattcgcaatgttgctcgctgctggtgctatgagaca
ggagttgcacttggaatggatgttgatgacaagatgccacaacatgagtattatgaatac
tttggtccagactatacgctccacgtcgctcctagtaacatggaaaataagaattcacat
ccgttacttgatgaaatacggtccaagcttcttgattatctttcaaagcttcagcatgca
cccagtatccaattccaagaaagacccccgaacactgatattccagaggcagatgaagat
caggatgatggggatgagagatgggaccccgattctgacatggatgttgatgatgagcgc
aagccattacccagcagagtgaagagagaaatcctcgaggccgagccaaaagatctggag
agtcaaaaaggaattgctgaccatgctcgaggctttgagacaacagcagacgagtccgca
agtgcaaaggctttagatatcggtgcgatgcaaattgatgaaccaagtgtgaaagttgaa
caggataacatgaacaagacaactgatcaagtgttttccaagtcatga

DBGET integrated database retrieval system