KEGG   Ricinus communis (castor bean): RCOM_0587660Help
Entry
RCOM_0587660      CDS       T01087                                 

Definition
tryptophan synthase beta chain, putative (EC:1.3.1.74)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_0587660
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCOM_0587660
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCOM_0587660
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCOM_0587660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MAASSTTTIPPNSYYKAHISSSSISKLYSFSQLPFKLKKFTKTCPSSSGLSVSCTLTREA
SAVKMEEEKEGSDPALWQRPDSFGRFGQFGGKYVPETLMYALSELESAFHSLKDDLDFQK
ELDGILKDYVGRETPLYFAERLTEHYGRPNGEGPHIYLKREDLNHTGAHKINNAIGQVLL
AKRLGKERIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMRLLGAEVR
AVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVREFHRIIGTETRRQAM
EKWGGKPDVLVACVGGGSNAMGLFDDFVNDKDVRLIAFKRLSRLEGIIPALETSHALAYL
EKLCPTLANGTKVVLNCSGRGDKDVQTAIKYLQL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcttctaccaccacaatacccccaaattcttattacaaagctcacatttct
tcttcatcaatctctaaactatattctttctctcaattgcccttcaagttgaaaaaattt
acaaagacttgcccttcaagtagtggattgtctgtatcttgcactttgactagagaggca
tcagctgtgaaaatggaggaggagaaagaagggtctgaccctgctttatggcaacgtcct
gattcttttggacgttttgggcaatttggtggcaaatatgtgcctgaaactttaatgtat
gctctttctgagcttgaatctgcctttcattctctcaaggatgacctggactttcagaaa
gaattagatgggattttgaaagactatgttggtagggaaactcctctttattttgctgag
cggctgacggagcattatggacgtcctaatggtgaaggaccacacatttatctcaagagg
gaagatctaaaccacacaggtgctcacaagatcaataatgccattggccaagttttgctt
gctaagcgtttggggaaggagcgcataatcgcagaaactggagctggtcagcatggagtt
gcaactgctacagtgtgtgcaagatttggtctgcagtgcattatctatatgggtgctcaa
gatatggaaagacaggcacttaatgttttcaggatgcgccttcttggtgctgaggtcaga
gcagttcattctgggacagccactctgaaggatgctacatcagaagctatacgggattgg
gtaactaacgtggagacaacccattatattttgggatctgtagctgggccgcatccttat
cccatgatggttcgggagttccataggattattggcacagaaacaagaaggcaagcaatg
gaaaaatggggtgggaagccagatgtacttgtggcatgtgttggtggaggatccaatgcc
atgggactttttgatgattttgtcaatgacaaggatgttagattgattgccttcaaaaga
ctatcacgattggaggggataatccctgctctggagacatctcatgcattggcgtatttg
gagaagctgtgcccaactcttgccaatggtactaaggttgtgcttaactgcagtggcaga
ggggataaggatgttcagaccgccatcaaatatttgcagctttga

DBGET integrated database retrieval system