KEGG   Ricinus communis (castor bean): RCOM_0612560Help
Entry
RCOM_0612560      CDS       T01087                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rcu00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:rcu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 578 aa AA seqDB search
MEIGPPSDVKESFMKYSEGRSHMTAEQLQRFLVEVQGDNAASISEAELILDQVLQKRHHM
TKCVRNSLTLDDFHYFLFSTDLNPPISDQVVQDMTAPLSHYFIYTGHNSYLTGNQIISNC
SDLPIEKALKRGLRAVELDVWPNSAKDDALVLHGWTFTAPVKLIKCLKSIKEHAFSASPY
PVIITLEDHLTENLQAKAAQMIVETFGDMLFYPNTECLEEFPSPEELKYKIIISTKSPKE
KGDLGVETMKVKEINSLKQNDSSEDMWEKDLSEISVHQEDDGKSDGDTSDENQNDECINA
CEQELRPREAPAYKNLILINARKPKGGLKQALKVELDKVRRLSLKEQKFEKVIASHGTDV
VRFTQRNILRIYPKGIRIDSSNYKPMNGWLHGAQMVALNMQGYGKPLWLMHGMFRANGGC
GYVKKPDFLMNVGPENQVFNPKEKLPVKKTLKVKIYMGNGWHLDFKRAQYALFSSPDFYI
RVGMAGAPADNTMKKTKKRENNWTPIWNEEFIFALTVPELALLRVEVHDRIMPEKDDFAG
QTCLPVSQLRPGIHAIPLFDRKGNKFSSMRLLMRFEFL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggagatcggacctccatcagacgtgaaggaatcatttatgaagtacagtgagggaagg
agtcacatgactgccgagcagctgcagcggttcttggtggaagttcagggtgataatgca
gcttcaatctctgaggctgagttgattctggatcaggttttgcaaaagcggcatcatatg
acaaagtgtgttcggaacagtctcactcttgatgattttcactatttccttttttcaaca
gatcttaatccacctattagtgatcaggtggtgcaagatatgacagcacctttgtcccat
tatttcatatatactggccataattcatatttgactggaaaccaaatcatcagtaactgc
agcgacctccctattgaaaaggcactcaagagaggtttgagagcagttgaactggatgta
tggccaaattcggcaaaggatgatgcgcttgttcttcatgggtggacatttacagctcct
gtgaagctaattaagtgtttgaagtccattaaagagcatgccttctctgcatctccatac
ccagtgataataactcttgaagaccacctcactgagaatcttcaggccaaagcagctcag
atgattgttgagacatttggagatatgctgttttatccgaatactgaatgcctagaagaa
ttcccttcacctgaggaattgaaatataagatcattatatcaaccaaatccccgaaagag
aaaggagaccttggagtggagaccatgaaagtaaaggaaattaactcactgaagcaaaac
gattctagtgaagatatgtgggagaaggatctatcagaaatttcagttcatcaagaagat
gatggaaagagtgatggcgatacaagtgatgagaatcagaatgatgagtgcattaatgca
tgtgaacaagaattgaggccaagagaagcacctgcatacaagaatctgattctgattaat
gctagaaagcccaagggtgggttaaagcaagcactcaaagttgagctggataaggtcaga
cgccttagcttgaaggagcaaaaatttgaaaaggttattgcatcccatggaacagatgtt
gtaagattcactcagaggaacattttgaggatatatcctaagggtatccgaattgactcc
tccaactacaagccaatgaatggttggttacatggagctcaaatggttgcccttaatatg
cagggatatggtaagcctctctggttgatgcatgggatgtttagagcaaatggtgggtgt
ggctatgtcaaaaagcctgattttctgatgaatgtgggtccagaaaatcaggtgttcaat
cctaaagagaagttgcctgtgaagaaaactttaaaggttaaaatttatatgggaaatgga
tggcacctggattttaagcgagcgcaatatgctttattttcctcaccagatttctatatc
agggttggcatggcaggggcaccagctgataatacaatgaagaaaacgaagaaaagggag
aacaattggacacccatttggaatgaagagtttatatttgcattgacagttccagagttg
gctttgcttcgtgttgaagttcatgaccgtatcatgcctgagaaggatgattttgcaggt
cagacatgtttgcctgtctctcaattgagaccaggcatccatgcaatccccctgtttgat
cgcaagggaaataagttcagttcaatgcgacttctcatgagattcgagtttctttag

DBGET integrated database retrieval system