KEGG   Ricinus communis (castor bean): RCOM_0618390Help
Entry
RCOM_0618390      CDS       T01087                                 

Definition
Cytochrome c, putative
Orthology
K08738  
cytochrome c
Organism
rcu  Ricinus communis (castor bean)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RCOM_0618390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MASFDQAPPGDVKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAA
NKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattcgatcaagcaccacctggcgatgtaaaagccggagagaaaatcttcaaa
actaagtgcgctcagtgccacaccgtcgagaaaggcgctggccacaaacaaggaccgaac
ttgaatgggctgtttgggagacaatcaggaacaactgcaggatattcatactctgcggct
aataagaatatggctgttcaatggggagagaatacgctttatgactacttgcttaaccct
aagaagtacatccctggaactaagatggtcttccctggattgaagaagccacaggaccgt
gcagacctcattgcctatctgaagcaagctactgcctga

DBGET integrated database retrieval system