KEGG   Ricinus communis (castor bean): RCOM_0618840Help
Entry
RCOM_0618840      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    RCOM_0618840
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RCOM_0618840
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     RCOM_0618840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 952 aa AA seqDB search
MSEGEIPANGCQEDREPSDSLLEKVDPGSPASLTWQRKLNSEDIALSQFNLSFQEKFQLA
PVGIRLWRLIREETAKGRVSIINPFLKRFITSCHGIPLGGIGSGSIGRSYKGEFQRWQLF
PRICEEKPVLANQFSVFVSRSSGEKYSSVLCPRNPEVLMEPAISGIGSWDWNLKGDNSTY
HALYPRAWTIYDGEPDPELRIVCRQISPIIPHNYKESSYPVSVFTFTLYNSGKTTADVSL
LFTWTNSVGGNSEYSGQHFNSTTMMEDGVHAVLLHHKTAEGFPPVTFAIAAQETNDVHVS
KCPRFVISGNCQGITAKDMWHEVKEHGSFDNLKSAGTSGPSEPGSSIGAAIAASVTIPPD
AIRSVTFSLSWDCPEVYFMGGRTYHRRYTKFYSTHGDAAARIAHDAILEHGLWESQIVAW
QRPILEDKRLPEWYPITLFNELYYLNSGGTIWTDGSPPYHNLVSIRGSKFSLDTSGAGLK
SIIDVTHENDTAVNILGRMTSALEQIHAHVASNSAFGTNLLQEGEENIGQFLYLEGIEYH
MWNTYDVHFYSSFALVMLFPKLELSVQRDFAAAVMMHDPSKMQLLHDGQWVCRKVLGAVP
HDIGINDPWYEVNAYSLYNTDRWKDLNPKFVLQVYRDVVATGDKKFAEAVWPSVYIAMAY
MDQFDRDGDGMIENDGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALAREVGDKGSEDY
FWARFQKAKDVYDKLWNGSYFNYDNSGGRNSSSIQADQLAGQWYARACGLFPIVDKDKAR
SALEKVYNYNVLKVKDGKRGAINGMLPDGKVDLSSMQSREIWSGVTYALAATMIQEDMLD
MAFHTASGIYEAAWSERGLGYSFQTPEAWNNVDQYRSLCYMRPLAIWAMQWALSRPKLEK
EEMEMEVNEDYLLPHHAGFTKVARFLRLPEGEESLGLLQSLFNYTCKKLGYN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggagagataccagcgaatggttgccaggaggacagagaaccttctgattct
ttgctggaaaaggttgaccctggaagtcctgcttcactgacctggcagcgaaagttaaat
agtgaggatattgccctgtcacagttcaatttaagttttcaagagaaatttcaattggct
cctgtaggtattcggttgtggcgtcttatccgagaagaaactgccaagggaagggttagc
attatcaatccatttcttaagcggtttataacatcttgtcatggcattccgcttggtggc
attggctctggaagcattggaagaagttacaaaggtgaatttcagcgttggcaactattt
cctagaatatgtgaagaaaaacctgttttagcaaatcaattttctgtctttgtttcacgc
tcaagtggtgagaagtactccagtgtactgtgcccaaggaatccagaggtgctaatggaa
cctgcaatttctggaatcgggtcatgggactggaatctaaagggagataattctacatat
catgctttgtatccaagggcatggaccatatatgatggtgaacctgatccagaacttaga
attgtttgtcgccaaatttcacctattattcctcataactataaagaaagcagctaccct
gtctcagttttcactttcacgctctataattctgggaagactactgcggatgtctctttg
cttttcacttggacaaattctgttggagggaattctgaatattctggtcagcacttcaat
tctacaacaatgatggaggacggtgtgcatgctgttcttctacatcacaagactgcagag
gggtttcctcctgtaacatttgctattgctgcacaggagacaaatgatgttcatgtctca
aaatgcccacgctttgtaatatcagggaactgccaaggcataacagcaaaagacatgtgg
catgaagtgaaagagcatggatcctttgacaaccttaagtctgctggaacatcagggcct
tcagaaccaggatcatctattggggcagccattgcagcctctgtgactattccaccagat
gcaatacgcagtgtcactttttcattgtcatgggactgccctgaagtatacttcatgggt
ggaaggacttatcacaggcgttatacaaaattctatagtacacatggcgatgctgctgca
agaattgcacatgatgcaattctagagcatggcctttgggaatcccaaatagtagcctgg
caaagaccaattcttgaagacaaaaggcttcctgaatggtatcctatcactctctttaat
gagctatattatcttaattcaggggggaccatttggacagatggatcacctccataccat
aatttagtaagcattaggggaagcaaattctcacttgatacgtcaggagcaggtttgaag
agcattattgatgtaacccatgaaaatgatactgcagttaatattcttggcaggatgact
tcagcacttgagcaaattcatgctcatgtggcttcaaactctgcttttggaactaatttg
cttcaagaaggagaagaaaatattggtcaatttctgtatcttgaagggattgaatatcac
atgtggaacacctatgatgttcatttctattcatcttttgcattggttatgctatttccc
aaacttgaactcagtgttcaaagagactttgctgcagcagtaatgatgcatgatcccagt
aagatgcaacttctacatgatggacaatgggtctgcagaaaggttcttggagctgttcct
catgatattggaattaatgatccatggtatgaagtaaatgcctatagcctttacaatact
gatcgatggaaagacttgaatccaaaatttgtcctccaagtttatagggatgtggttgcc
acaggtgacaagaagtttgcagaagcagtttggccctcagtttacattgcgatggcatat
atggaccagtttgacagggatggtgatgggatgattgagaatgatggctttcctgatcag
acatatgatacatggtccgtgtctggtgtgagtgcgtatagtggtgggctatgggtggca
gctttgcaggctgcatcagccttggcacgagaagttggtgacaagggttctgaggattac
ttttgggctaggtttcagaaagcaaaagatgtgtatgataaattatggaatggttcttac
ttcaattatgacaacagtggtggtagaaatagctcatctattcaggctgatcaattggct
ggacaatggtatgcacgagcatgtggacttttcccaattgttgacaaagacaaggcaaga
agtgcactagagaaggtttataactacaatgtcttgaaggtgaaggatggaaaacgaggg
gctatcaatggaatgctaccggatggaaaagttgacctatcatcaatgcagtcaagagag
atatggtctggagtcacatatgctcttgctgcaacaatgattcaggaagatatgttggat
atggcttttcacacagcaagtggtatctatgaagctgcttggtctgaaaggggactcggg
tactctttccaaactccggaagcttggaacaatgttgaccagtatagatctctctgttac
atgcgccctttggccatttgggcaatgcagtgggctctgtcaagaccaaaactcgaaaaa
gaggaaatggaaatggaagtgaatgaagattatctgcttccgcaccacgctggattcacc
aaagtcgctcgcttcctgagattgccagaaggggaagaatctctaggtcttctccaatct
ttgtttaactatacttgcaagaagttgggttataactga

DBGET integrated database retrieval system