KEGG   Ricinus communis (castor bean): RCOM_0620800Help
Entry
RCOM_0620800      CDS       T01087                                 

Definition
choline/ethanolamine kinase, putative (EC:2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rcu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 332 aa AA seqDB search
MGAVENAIVNKESRIPLEAKEILKSIASKWEDVVDANALQIIPLKGAMTNEVFQIKWPTK
TENGSHKVLVRIYGEGVEIFFDRDDEIKTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTL
SACDLRDPDISALIAAKLKEFHGLEMPGSKNVSLWIRLRNWLNTAKSMCPPEEAKAFHLD
TIEVEISLLEKELSGDQRIGFCHNDLQYGNIMIDEETKAITIIDYEYSSYNPIAFDIANH
FCEMAADYHSNTPHIMDYSKYPGDRVSDIEVEQLLEDVEKYTLASHLFWGLWGIISEHVN
EIDFDYMEYARQRFEQYWLRKPELLGSLGSHT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgtggagaatgcaatagtgaataaagaaagtagaataccattagaggcaaag
gagatcttaaagtcaatagcttcaaaatgggaagatgtggttgatgcaaatgcattgcag
attatacctcttaaaggtgcaatgactaatgaggtttttcaaataaagtggccaacaaaa
actgagaatggttcacataaagttcttgttaggatttatggtgagggtgtagagattttc
tttgatagggatgatgagatcaagacttttgaattcatgtctaagcaagggcaaggccct
cggcttcttgggcggttctcaaatgggcgaatcgaagagttcatacatgctcggacacta
tcagcatgtgatttgcgtgatccagatatatctgcccttatagcagctaaattgaaggag
tttcatggtcttgagatgcctggttcaaagaatgtcagcctgtggattaggttgcgaaat
tggctgaatacagctaagagtatgtgtcctcctgaagaagctaaagcctttcacttggat
accatcgaggtggaaatttcattattggaaaaggagctctctggagatcaaagaattggt
ttttgtcataacgatttacaatatggtaacatcatgattgatgaagagactaaagcaata
accataatagattatgaatattcaagttacaatcctattgcctttgatatagcaaaccac
ttctgtgagatggccgccgactatcactctaatacacctcatattatggactacagtaaa
taccctggtgatcgagttagtgacattgaggtggaacagctcctggaagatgttgagaag
tacacacttgctagccatctgttttggggcttgtgggggattatatcggaacatgtcaac
gaaattgattttgattacatggaatatgcaaggcagaggtttgaacagtactggttaagg
aagcctgaacttttgggttccttggggagccacacctaa

DBGET integrated database retrieval system