KEGG   Ricinus communis (castor bean): RCOM_0636070Help
Entry
RCOM_0636070      CDS       T01087                                 

Definition
eukaryotic translation initiation factor 4e, putative
Orthology
K03259  
translation initiation factor 4E
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    RCOM_0636070
Translation factors [BR:rcu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    RCOM_0636070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MAVEEPQKLTIPNSEETPNRNPNPNPSDVKEDEVEEGEIVGGEGEEESTAKSALIYEAHP
LEHQWTFWFDNPSAKSKQATWGSSMRPIYTFATVEEFWSIYNNIHHPSKLAVGADFHCFK
HKIEPKWEDPVCANGGKWTLTFQKGKSDGSWLNTLLAMIGEQFERGDEICGAVVSVRARQ
EKIALWTKNAANEAAQLSIGKQWKELLDYNDTIGFIFHDDAKKHERSAKNRYTI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagaggagccacagaaattaacaataccaaacagtgaagagacgccaaaccgt
aaccctaacccaaaccctagcgacgttaaagaagatgaggtggaagaaggagagatcgta
ggaggagagggggaggaggaatcaacggctaagagtgcgttaatatacgaggcgcatccg
ctggagcatcaatggactttctggttcgataatccgtcggctaaatcaaagcaagccact
tggggaagttctatgcgtcctatttacacttttgctactgttgaagagttctggagcatt
tacaataatatacatcatccaagtaagctggctgtgggggctgactttcattgtttcaaa
cataaaattgagccaaaatgggaggaccctgtttgtgctaatggaggaaagtggacatta
acctttcaaaaagggaaatctgatggcagttggctgaacacgttgctggctatgatcgga
gagcagtttgagcgtggagatgaaatatgtggagcagttgtcagcgtcagagctaggcag
gaaaagatagctctttggactaagaatgccgcaaatgaagctgctcagctgagcattgga
aaacaatggaaggagcttcttgattataatgatactattggatttatattccatgatgat
gcaaagaagcatgagagaagtgccaagaatcgctacacgatatga

DBGET integrated database retrieval system