KEGG   Ricinus communis (castor bean): RCOM_0639420Help
Entry
RCOM_0639420      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     RCOM_0639420
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_0639420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 834 aa AA seqDB search
MNNLQGAGLENLGNTCFLNSVLQCLTYTEPLAAYLQSGKHQTSCHIAGFCALCAIQKHVS
RALQSTGRSLVPKDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVPSESPA
AYEKSLVHKIFGGRLRSQVECQQCSYCSNKFDPFLDLSLEIVKADTLPVALRNFTAAELL
DGGEKHYQCQKCKQKVRAKKRLTVHNAPNVLTIHLKRFHAHDPGRKVDKKVLFDHSLDMK
PFVSGSYEGDLKYSLYGVLVHFGHSTHSGHYVCFIRTSSGIWHLLNDNEVRPVSEKVVLD
QKAYMLFYVRDRKANATKRPADVVRKENVKASISSNLPNLVLKQMSKEHIDNGLIGNRSF
AANSTASVNKKDGLNFSTSKEIPQKEALDRPSFSECSLRKTNSIAEPSSSSPLPEDSSKG
VTPNPDLRECLSPSATSMNSKLDAAKLDNTNITTGVKVTGSNKAFSNCNETQNCPVENLV
TNESSEKINLVINMGVNGAEEMVPGLPQSDSSDKMSNRIVSVKVPNKPTCGSIQGGDFPN
QSAAGNSQRDQGGHSCQHIVNELAEPSILSITPNQCLHKKAPDCTPHKKFKKLLRHRISN
MPLGLKFFRASLGLRKRKKHKKSKRGTVGTQNLIKEQVMEGNCSLLEVGPSTSKMSMSVS
LISTNSQRKKAKSSSKCRDDTGMDIVDEELKRYNQNSDAAPMDKHIENSISTSEVNQHEA
VLLDCRESRGENMPENGNMCILTRGLEETTVACWDGIALPQSQIVESSNEENLRIGYVPD
EWDEEYDRGRRKKVRQNKQDFGGPNLFQEYASKKTQFKKAKMDQSSSGNKPFRI
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcttcagggggctggtttggaaaatctcggaaacacttgttttctcaattcg
gttttgcaatgtctgacatacactgagcctttggcagcgtatttacagagtggcaagcat
caaacttcttgccatattgctggtttttgcgcattgtgtgccatccagaaacatgttagc
cgtgctctgcaatcaactgggagatcactggtacccaaggatcttgtttccaatttgcgc
tgcatatctcggaacttcagaaatgccagacaggaggatgctcatgagtacatggtaaac
ttgctggaatcaatgcataaatgctgcttaccttcaggagtaccaagtgaatctcctgcc
gcttatgaaaagagtttagttcacaaaatctttggcgggcgcctccgtagtcaggtggaa
tgtcaacaatgctcatactgctccaacaagtttgatccatttttagatttaagccttgaa
atagttaaggcagatactttaccagttgcacttcggaacttcactgctgcagagctatta
gatggaggagagaagcattatcagtgccaaaaatgcaagcaaaaagttagagctaagaaa
cggctaactgtccacaatgctccaaatgtgcttacaatccatttaaagcgctttcatgca
catgatcctggacggaaagttgacaagaaagttttgtttgatcattcgttagacatgaaa
ccttttgtcagcggttcctatgaaggagatttgaagtatagtctctatggtgttctggtg
cattttggccacagtacccattctggtcattatgtatgtttcattcgcacatcaagtggt
atatggcatctcctcaatgacaacgaggttcgtccagttagcgagaaggttgttctagac
cagaaggcttatatgttattttatgtccgtgatagaaaagctaatgctacaaaaaggcct
gccgatgtggttcgaaaagaaaatgtgaaagcaagtatcagcagtaaccttccaaatttg
gttttaaagcaaatgtcaaaggaacatattgataatggtttaattggaaatagatcattt
gctgcgaactccactgcttctgttaataaaaaagatggactaaatttcagtacatcaaag
gagatccctcagaaggaagcattagatcggccatcattttcagaatgctcattgagaaaa
acaaactctattgcagaaccttcttcaagttcaccattgccagaggactcatcaaaagga
gttactccaaaccctgatctgagagaatgcttgtcaccttcagctacatctatgaacagc
aaacttgacgctgctaagttggataacactaacatcacaactggggttaaagtgactggt
tctaataaggcattttctaactgtaatgagacccagaattgtcctgttgaaaatctggtg
acaaatgagtcctcagaaaagattaatctcgtcataaatatgggagttaatggtgcagaa
gagatggtcccaggactccctcaatctgattctagtgacaaaatgtcaaacagaatcgtc
tctgtcaaagtaccaaataaacctacctgtggaagcattcagggcggagatttccccaat
cagagcgctgctggaaattcacagagagatcaaggtggtcatagttgtcaacatattgtg
aatgagttggctgaaccatcaatcctgtcaattacaccaaatcagtgtctgcataagaag
gctcctgattgcacacctcacaaaaaatttaagaagcttttgaggcataggatttccaat
atgcctcttggcttaaaatttttcagagcatccttaggcctgcgaaaaaggaagaaacac
aaaaagagcaagcgtggcactgtagggacccaaaatcttataaaagaacaggtgatggag
ggtaactgttcattgttagaggttgggccctctacatccaagatgtccatgtcagtttca
ttaatttcaacaaattctcaaaggaaaaaggctaaatctagttcgaagtgtagagatgac
accgggatggatattgtggatgaagaattgaagagatataaccagaacagtgatgcagct
ccaatggataaacatatagagaactctatttcaacatctgaagtgaaccaacatgaagca
gttctacttgattgtagagaaagtaggggggaaaatatgccagagaatgggaatatgtgt
atactcacacgaggtctggaagagacaactgttgcatgttgggatgggatagcgttgcct
caatcacaaattgtggaatcgagtaacgaggaaaatctccgcattggttatgtgcctgat
gagtgggatgaagaatatgatcgaggtaggagaaagaaggtgaggcagaataagcaagac
tttggcgggccaaatctattccaagaatatgcaagcaaaaagacgcaattcaagaaggcg
aaaatggaccaatccagctctggaaacaaacctttcaggatatga

DBGET integrated database retrieval system