KEGG   Ricinus communis (castor bean): RCOM_0654720Help
Entry
RCOM_0654720      CDS       T01087                                 

Definition
threonine synthase, putative (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_0654720
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCOM_0654720
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RCOM_0654720
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RCOM_0654720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MAASSLLQSPHLNNPKLTSKPKSIFHNGHKPIPYFLSIRASTSDPSHTPSPTPTPTPTTS
SRGCNIRDEARRQNLSNPPPSNNFSAKYVPFNAGPACTESYSLDEIVYRSQSGGLLDVQH
DMSALKAFPGSYWRALFDSRVGKTNWPYGSGVWSKKEWVLPEISSDDIVSAFEGNSNLFW
AERYGKQFLDMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNKPVVGVGCASTGDT
SAALSAYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAEL
PIYLANSLNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGL
VDRIPRLVCAQAANANPLYLYYKSGWKDFKPVKASSTFASAIQIGDPVSIDRAVYALKNS
NGIVEEATEEELMDAMAQADSTGMFICPHTGVALSALIKLRNSGVIGPTDRTVVVSTAHG
LKFSQSKIDYHSSDIQDMACRFANPPVSVKADFGSVMDVLKKYLLSKETKY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcttcacttctccaatctccccaccttaataaccccaaactcacctctaaa
ccgaaatccatttttcataatggacataaacccattccctattttctttccatcagagct
tccacctctgatccatcccacactccgtctccaactccaactccaactccaacaacctcc
agtagaggatgcaacattcgcgacgaggcccgtcgccagaacttatcaaacccaccgccc
agcaacaatttctccgcaaagtacgttcctttcaatgcaggacctgcttgtacagaatcc
tattcactcgatgagatcgtttaccgctctcagtcaggtgggctccttgatgttcagcat
gacatgtctgctctcaaggcatttccgggttcttactggcgtgcccttttcgattctaga
gtagggaagactaactggccttatggatccggagtttggtctaaaaaggaatgggtttta
cctgagatatcaagtgatgatattgtcagtgcatttgaagggaactcgaatctgttttgg
gctgagagatatggtaagcagtttctggatatgaatgatttgtgggttaagcattgtggg
attagtcatactgggagttttaaagatttgggtatgactgttttggttagtcaagttaat
agattgaggaaaatgaataaacctgttgttggtgttggctgtgcttctactggtgatact
tctgctgcattatctgcttattgtgcttctgctggtattccttctattgtatttttacca
gctaataagatttccatggctcaattagtacagcctattgctaatggagcttttgttttg
agtattgatactgattttgatgggtgtatgcagttaatacgagaggttactgctgagttg
cctatttatttagctaattcattgaatagtttgagattagaagggcaaaaaactgctgca
attgagattttgcagcagtttgattgggaagtgcctgactgggttattgttcctggaggt
aatttagggaatatatatgctttttataaagggttttatatgtgtaaggagttgggactt
gtggacaggattcctagactagtttgtgcacaagctgctaatgcaaatcctctttatctg
tactataagtcagggtggaaagattttaaacctgttaaagcaagtagtacatttgcatct
gctattcagattggcgatcctgtttcaattgatagagctgtttatgcattgaaaaattca
aatgggattgttgaggaagctactgaggaggagctaatggatgcaatggcacaagcagat
tctactgggatgtttatatgtccacatacaggggtggcattgtcagcattgattaagctc
aggaatagtggagttatagggcctactgatcgaacagtggtagtgagtactgctcatggg
ttgaagtttagtcagagcaagattgattaccactctagtgatattcaggacatggcttgt
aggtttgctaatccgcctgtgagtgttaaggcagattttgggtccgtcatggatgtttta
aagaagtatttgttgagtaaagaaacaaagtattag

DBGET integrated database retrieval system