KEGG   Ricinus communis (castor bean): RCOM_0654800Help
Entry
RCOM_0654800      CDS       T01087                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_0654800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0654800
   00020 Citrate cycle (TCA cycle)
    RCOM_0654800
   00620 Pyruvate metabolism
    RCOM_0654800
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCOM_0654800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MAYASHIINHSKKLRNVSNLLRQEHAGLVRWFSNDTRLSVGKKDDTAKVHHQGFVPAERE
RLFNTGVNNNISSFGAFRKNVPRTIKQVRNPMDGSLLLKDFSSSQVQSRRGFSSDSGLPP
HQEIGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGFLAKIIK
GDGSKEIKVGEVIAITVEDEEDIGKFKDYSPSVSDGAAAASPPPPSKKEVAEETVSSPEP
KTSKPSAASSGDRIFASPLAKKLAEDHNVTLSSIKGTGPDGHIVKADIEDYLASRGKEVS
ATTPKATAASIDYVDIPHTQIRKVTASRLLLSKQTIPHYYLTVDTRVDKLMDLRGKLNSL
QEASGGKRISVNDLVIKAAALALKRVPQCNSSWTDNYIRQYNNVNINVAVQTDNGLYVPV
VRDADKKGLSKIAEEVKHLAQKAKDNSLKPEDYEGGTFTVSNLGGPFGIKQFCAIINPPQ
SGILAVGSAEKRVIPGSGPDEFKFASFMLVTLSCDHRVIDGAIGAEWLKAFKGYIENPES
MLL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgcatctcacataatcaatcactcgaaaaagttaagaaatgtttccaacttg
ctgaggcaagaacatgctggtttggttcgttggttttcgaacgatactcgcttgtctgta
ggtaaaaaggatgatactgcgaaggttcatcatcaggggtttgtgcctgcagaaagggag
agattgtttaacaccggtgttaataacaatatatcatcatttggtgcatttaggaaaaat
gtaccaaggacaataaagcaagtgaggaatccaatggatgggtcgctactcttgaaggac
ttctctagttcccaggtacaatcaagaagaggattttcatctgattcaggtcttcctcca
caccaagaaattggaatgccttcgctctcaccaacaatgaccgagggtaatatagcaagg
tggctgaagaaagagggtgacaaaatctcacctggtgaagtactatgtgaagttgaaact
gataaagcaactgttgagatggaatgcatggaagaaggtttccttgcaaagataataaag
ggagatgggtctaaagaaattaaagttggtgaggtaattgctattactgttgaagatgag
gaagatattggcaaatttaaggattacagtccttcggtatcagatggtgctgctgcagct
agcccacctcccccatccaagaaagaggtggctgaggaaacagttagttcaccagaacca
aagacttccaagcccagtgcagcttcctctggagatcgcatttttgctagtcctcttgca
aaaaaattggctgaagatcacaatgtaactctctcaagcattaaaggaacaggtcctgat
ggacacatcgtaaaagctgatattgaagattacttggcatcacgtggaaaggaagtttca
gcaacaacacctaaggcaacagctgcttcaattgattatgttgacattcctcatactcaa
ataagaaaggttacagcctcacgcttattactctcaaagcagactattcctcattattat
ttaacagtagatacacgtgttgacaaacttatggatttgcggggtaaattaaactcatta
caagaggcctcaggtgggaagcggatttctgtaaatgatcttgtaatcaaggctgctgct
ttggctcttaaaagagttccccagtgcaacagttcatggactgataactatatccgccag
tataacaatgtgaacatcaatgtagcagtacagacagataatggactatatgtcccagtt
gttagggacgcagacaaaaaaggtttatctaaaattgccgaggaggtcaagcatttggcc
caaaaagccaaagacaatagcttgaaaccagaagattacgagggaggcacatttactgtg
tcaaatttgggagggccctttggcatcaagcaattctgtgccattatcaatcctcctcaa
tcaggcattttagcagttggctccgctgagaagagagtcattcctggttcggggcctgat
gaattcaaatttgcttccttcatgttagtaacattgagctgtgatcatcgtgttatagat
ggtgcaattggagcagaatggttaaaagcattcaagggctacattgagaatcctgaatca
atgttgctgtaa

DBGET integrated database retrieval system