KEGG   Ricinus communis (castor bean): RCOM_0659450Help
Entry
RCOM_0659450      CDS       T01087                                 

Definition
3-hydroxybutyryl-CoA dehydratase, putative (EC:4.2.1.17)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_0659450
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RCOM_0659450
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCOM_0659450
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RCOM_0659450
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     RCOM_0659450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MASPTSAEGQNEQVLVEENLFARTLILNRPKQLNALSFKMISRLLDLFLAYEEDPNVKFL
VLKGNGRAFCAGGDVSAVVRDIREGNWRLGAKFFEKEFILNYVMATYTKPQVSILNGIVM
GGGAGASMHGRFRVATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGARLDG
AEMLTCGLATHFVPSTKLYLLEEALHKIDSSDPDIISSIIDGYCQQPYLKEQSAYCWLHA
IDRCFSQRSVEDIISALEREAMKNKADAWISTTIQLLKKASPTSLKISLRSIREGRLQGV
GQCLVREYRMVCHVMRGKLSNDFFEGCRAILLDKDKNPKWEPPKLGLVCDSKVEQYFSKV
DDGEWEDLKLRARFNLPGCATAKL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccacctcagcagaaggccagaatgagcaggttttggtagaggagaacttg
tttgcaagaaccttgatattaaacagacctaaacagttgaatgctctttcctttaaaatg
atttctcggctgctggacctttttcttgcttacgaggaggatcctaatgtcaaattcctt
gttctcaagggaaatggcagagcattttgtgctggtggtgatgtttctgctgtggttcgt
gatatacgtgaaggtaattggagattaggtgccaagttctttgaaaaggaattcattttg
aactatgtgatggcgacttacactaaaccccaggtctcaatccttaacggaattgtcatg
ggaggcggtgctggagcttcaatgcatggaagattccgcgttgcaactgagaattcggtc
tttgcaatgcctgaaacagctctagggctttttcctgatgtaggtgcctcttattttttg
tcaagacttcctggattctttggagaatatcttggacttacaggtgctagattggatggt
gctgaaatgctcacatgtggacttgcaactcactttgtcccatcaacaaagttgtatttg
ttagaagaagcattgcataaaatagattcaagtgatccagacatcatttcatccattatt
gatggatactgtcagcaaccatatttgaaagagcaaagcgcttattgctggttgcatgcc
attgatagatgtttttctcaaagatctgttgaagatattatatcagcccttgagagggag
gccatgaaaaataaggcagatgcttggatctctacgacaattcagttactgaagaaggct
tctccaacaagtcttaaaatttctcttagatcaattagagaaggaaggcttcaaggtgtt
ggtcaatgccttgttcgcgagtatagaatggtttgccatgtcatgcgaggaaaacttagc
aatgatttttttgagggttgcagagctatattgttagataaggataagaatccaaagtgg
gaacctccgaaattgggcctcgtctgcgacagtaaggttgagcaatacttctccaaagtg
gatgatggagaatgggaagatctaaagcttcgtgctcgtttcaacttgcctggatgtgcc
actgctaagctataa

DBGET integrated database retrieval system