KEGG   Ricinus communis (castor bean): RCOM_0660930Help
Entry
RCOM_0660930      CDS       T01087                                 

Definition
triosephosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_0660930
   01230 Biosynthesis of amino acids
    RCOM_0660930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_0660930
   00051 Fructose and mannose metabolism
    RCOM_0660930
   00562 Inositol phosphate metabolism
    RCOM_0660930
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCOM_0660930
Enzymes [BR:rcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCOM_0660930
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCOM_0660930
  Exosomal proteins of bladder cancer cells
   RCOM_0660930
  Exosomal proteins of melanoma cells
   RCOM_0660930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MAMLSTSLSGPSQFSGLRQSCPKLLETHSLSQSFLRHFNSQLRSISSSRKPSRHVVAMAG
TGTFFVGGNWKCNGTKESISKLVSDLNDAKLEADVDVVVAPPFIYIDQVKSSLTDRIEIS
AQNSWVSKGGAFTGEISVEQLNDIGCKWVILGHSERRHVIGENDEFIGKKAAYALSQGLG
VIACIGELLEEREAGKTFDVCFQQLKAYADAVPSWDKIVIAYEPVWAIGTGKVATPQQAQ
EVHVALRDWLKKNISEEVASKTRIIYGGSVNGGNCAELAKQEDIDGFLVGGASLKGPEFA
TIINSVTSKKVAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctatgctatctacttcgctctcaggtccctctcagttctccggccttcgccaatca
tgccctaaacttcttgagactcactccctctctcagtcatttcttcgtcatttcaattct
caacttcgcagcatctcttcttctcgcaaaccttctagacatgtcgtcgctatggccggc
acgggaacgttctttgtaggaggcaattggaagtgtaatgggacaaaagagtctatcagt
aagcttgtttctgacttgaacgatgcgaagttggaggctgatgttgatgttgttgttgct
cctccctttatttacatcgatcaggtgaagtcttcattaacagatagaattgagatttct
gctcaaaactcctgggtcagtaaaggtggggctttcacaggagagatcagtgtggaacaa
ctaaatgatattggctgcaagtgggttattcttgggcattctgaacgcaggcatgtaatt
ggagaaaatgatgagtttataggaaagaaagctgcatatgccttgagccagggtcttggg
gtgatagcttgtattggtgaacttttagaagaaagagaggcaggaaaaacttttgatgtt
tgttttcagcaattgaaggcatatgccgatgctgtgcccagttgggataagattgttatt
gcatatgagccggtatgggctattggaactggtaaagtggccacacctcagcaagctcag
gaagtgcatgttgctttacgagattggctcaaaaagaatatctctgaagaagttgcatcc
aaaacacgaattatctatggaggatctgtaaatgggggaaattgtgctgaacttgcgaag
caagaagatattgatggttttcttgttggtggtgcatccctaaagggcccggaatttgct
accattatcaattctgtaacatccaagaaagttgctgcttga

DBGET integrated database retrieval system