KEGG   Ricinus communis (castor bean): RCOM_0660930Help
Entry
RCOM_0660930      CDS       T01087                                 

Definition
triosephosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rcu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rcu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rcu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rcu00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rcu00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MAMLSTSLSGPSQFSGLRQSCPKLLETHSLSQSFLRHFNSQLRSISSSRKPSRHVVAMAG
TGTFFVGGNWKCNGTKESISKLVSDLNDAKLEADVDVVVAPPFIYIDQVKSSLTDRIEIS
AQNSWVSKGGAFTGEISVEQLNDIGCKWVILGHSERRHVIGENDEFIGKKAAYALSQGLG
VIACIGELLEEREAGKTFDVCFQQLKAYADAVPSWDKIVIAYEPVWAIGTGKVATPQQAQ
EVHVALRDWLKKNISEEVASKTRIIYGGSVNGGNCAELAKQEDIDGFLVGGASLKGPEFA
TIINSVTSKKVAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctatgctatctacttcgctctcaggtccctctcagttctccggccttcgccaatca
tgccctaaacttcttgagactcactccctctctcagtcatttcttcgtcatttcaattct
caacttcgcagcatctcttcttctcgcaaaccttctagacatgtcgtcgctatggccggc
acgggaacgttctttgtaggaggcaattggaagtgtaatgggacaaaagagtctatcagt
aagcttgtttctgacttgaacgatgcgaagttggaggctgatgttgatgttgttgttgct
cctccctttatttacatcgatcaggtgaagtcttcattaacagatagaattgagatttct
gctcaaaactcctgggtcagtaaaggtggggctttcacaggagagatcagtgtggaacaa
ctaaatgatattggctgcaagtgggttattcttgggcattctgaacgcaggcatgtaatt
ggagaaaatgatgagtttataggaaagaaagctgcatatgccttgagccagggtcttggg
gtgatagcttgtattggtgaacttttagaagaaagagaggcaggaaaaacttttgatgtt
tgttttcagcaattgaaggcatatgccgatgctgtgcccagttgggataagattgttatt
gcatatgagccggtatgggctattggaactggtaaagtggccacacctcagcaagctcag
gaagtgcatgttgctttacgagattggctcaaaaagaatatctctgaagaagttgcatcc
aaaacacgaattatctatggaggatctgtaaatgggggaaattgtgctgaacttgcgaag
caagaagatattgatggttttcttgttggtggtgcatccctaaagggcccggaatttgct
accattatcaattctgtaacatccaagaaagttgctgcttga

DBGET integrated database retrieval system